A4GALT antibody
-
- Target See all A4GALT Antibodies
- A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This A4GALT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- A4 GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHE
- Top Product
- Discover our top product A4GALT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
A4GALT Blocking Peptide, catalog no. 33R-7959, is also available for use as a blocking control in assays to test for specificity of this A4GALT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 ALT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))
- Alternative Name
- A4GALT (A4GALT Products)
- Synonyms
- A14GALT antibody, A4GALT1 antibody, Gb3S antibody, P(k) antibody, P1 antibody, P1PK antibody, PK antibody, Gb3 antibody, alpha 1,4-galactosyltransferase (P blood group) antibody, alpha 1,4-galactosyltransferase antibody, A4GALT antibody, A4galt antibody
- Background
- The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system.
- Molecular Weight
- 40 kDa (MW of target protein)
-