A4GALT antibody

Catalog No. ABIN635990

Product Details anti-A4GALT Antibody

Target: A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This A4GALT antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: A4 GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

A4GALT Blocking Peptide, catalog no. 33R-9678, is also available for use as a blocking control in assays to test for specificity of this A4GALT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 ALT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for A4GALT

Target: A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))

Alternative Name: A4GALT (A4GALT Products)

Synonyms: A14GALT antibody, A4GALT1 antibody, Gb3S antibody, P(k) antibody, P1 antibody, P1PK antibody, PK antibody, Gb3 antibody, alpha 1,4-galactosyltransferase (P blood group) antibody, alpha 1,4-galactosyltransferase antibody, A4GALT antibody, A4galt antibody

Background: The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system.

Molecular Weight: 40 kDa (MW of target protein)