Neuropilin 1 antibody (N-Term)

Catalog No. ABIN635997

Product Details anti-Neuropilin 1 Antibody

Target: Neuropilin 1 (NRP1)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Neuropilin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Neuropilin antibody was raised against the N terminal of NETO2

Purification: Affinity purified

Immunogen: Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Neuropilin Blocking Peptide, catalog no. 33R-2574, is also available for use as a blocking control in assays to test for specificity of this Neuropilin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NETO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Neuropilin 1

Target: Neuropilin 1 (NRP1)

Alternative Name: Neuropilin (NRP1 Products)

Synonyms: NRP1 antibody, cd304 antibody, neuropilin antibody, np-1 antibody, npn-1 antibody, nrp antibody, nrp-1 antibody, vegf165r antibody, BDCA4 antibody, CD304 antibody, NP1 antibody, NRP antibody, VEGF165R antibody, C530029I03 antibody, NP-1 antibody, NPN-1 antibody, Npn1 antibody, Nrp antibody, neuropilin 1 antibody, neuropilin 1 L homeolog antibody, NRP1 antibody, nrp1 antibody, Nrp1 antibody, nrp1.L antibody

Background: NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals