CASD1 antibody (N-Term)

Catalog No. ABIN636009

Product Details anti-CASD1 Antibody

Target: CASD1 (CAS1 Domain Containing 1 (CASD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CASD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CASD1 antibody was raised against the N terminal of CASD1

Purification: Affinity purified

Immunogen: CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CASD1 Blocking Peptide, catalog no. 33R-5598, is also available for use as a blocking control in assays to test for specificity of this CASD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CASD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CASD1

Target: CASD1 (CAS1 Domain Containing 1 (CASD1))

Alternative Name: CASD1 (CASD1 Products)

Synonyms: zgc:136291 antibody, si:dkey-104m9.2 antibody, C7orf12 antibody, NBLA04196 antibody, Cas1 antibody, Cast1 antibody, CAS1 domain containing 1 antibody, CAS1 domain-containing protein 1 antibody, CASD1 antibody, casd1 antibody, CpipJ_CPIJ003344 antibody, LOC100540591 antibody, Casd1 antibody

Background: The function of CASD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 91 kDa (MW of target protein)