CRISPLD2 antibody (N-Term)
-
- Target See all CRISPLD2 Antibodies
- CRISPLD2 (Cysteine-Rich Secretory Protein LCCL Domain Containing 2 (CRISPLD2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRISPLD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CRISPLD2 antibody was raised against the N terminal of CRISPLD2
- Purification
- Affinity purified
- Immunogen
- CRISPLD2 antibody was raised using the N terminal of CRISPLD2 corresponding to a region with amino acids MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
- Top Product
- Discover our top product CRISPLD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CRISPLD2 Blocking Peptide, catalog no. 33R-6404, is also available for use as a blocking control in assays to test for specificity of this CRISPLD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRISPLD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRISPLD2 (Cysteine-Rich Secretory Protein LCCL Domain Containing 2 (CRISPLD2))
- Alternative Name
- CRISPLD2 (CRISPLD2 Products)
- Synonyms
- MGC107747 antibody, CRISP11 antibody, LCRISP2 antibody, 1810049K24Rik antibody, Lcrisp2 antibody, Lgl1 antibody, coffeecrisp antibody, cysteine rich secretory protein LCCL domain containing 2 antibody, cysteine-rich secretory protein LCCL domain containing 2 antibody, CRISPLD2 antibody, crispld2 antibody, Crispld2 antibody
- Background
- CRISPLD2 is a novel NSCLP candidate gene.
- Molecular Weight
- 56 kDa (MW of target protein)
-