B3GALT6 antibody (N-Term)

Catalog No. ABIN636025

Product Details anti-B3GALT6 Antibody

Target: B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GALT6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: B3 GALT6 antibody was raised against the N terminal of B3 ALT6

Purification: Affinity purified

Immunogen: B3 GALT6 antibody was raised using the N terminal of B3 ALT6 corresponding to a region with amino acids EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GALT6 Blocking Peptide, catalog no. 33R-2691, is also available for use as a blocking control in assays to test for specificity of this B3GALT6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GALT6

Target: B3GALT6 (UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6))

Alternative Name: B3GALT6 (B3GALT6 Products)

Synonyms: B3GALT6 antibody, MGC69183 antibody, Dyak\\GE22868 antibody, GE22868 antibody, beta3galt6 antibody, dyak_GLEANR_663 antibody, Dere\\GG10628 antibody, GG10628 antibody, dere_GLEANR_10535 antibody, Dper\\GL21178 antibody, GL21178 antibody, dper_GLEANR_3106 antibody, Dsec\\GM20673 antibody, GM20673 antibody, dsec_GLEANR_3487 antibody, Dpse\\GA28758 antibody, GA28758 antibody, dpse_GLEANR_8882 antibody, EDSP2 antibody, SEMDJL1 antibody, beta3GalT6 antibody, BB129894 antibody, GalTII antibody, beta-1,3-galactosyltransferase 6 antibody, Beta-1,3-galactosyltransferase 6 antibody, UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 antibody, UDP-Gal:betaGal beta 1,3-galactosyltransferase, polypeptide 6 antibody, B3GALT6 antibody, b3galt6 antibody, CpipJ_CPIJ010407 antibody, Dyak\beta3galt6 antibody, Dere\beta3galt6 antibody, Dper\beta3galt6 antibody, Dsec\beta3galt6 antibody, Dpse\beta3galt6 antibody, LOC100285906 antibody, B3galt6 antibody

Background: B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process