TM4SF4 antibody (N-Term)
-
- Target See all TM4SF4 Antibodies
- TM4SF4 (Transmembrane 4 Superfamily Member 4 (TM4SF4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TM4SF4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TM4 SF4 antibody was raised against the N terminal of TM4 F4
- Purification
- Affinity purified
- Immunogen
- TM4 SF4 antibody was raised using the N terminal of TM4 F4 corresponding to a region with amino acids CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG
- Top Product
- Discover our top product TM4SF4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TM4SF4 Blocking Peptide, catalog no. 33R-1822, is also available for use as a blocking control in assays to test for specificity of this TM4SF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TM4SF4 (Transmembrane 4 Superfamily Member 4 (TM4SF4))
- Alternative Name
- TM4SF4 (TM4SF4 Products)
- Synonyms
- ILTMP antibody, il-TMP antibody, Lrtm4 antibody, Iltmp antibody, transmembrane 4 L six family member 4 antibody, transmembrane 4 superfamily member 4 antibody, TM4SF4 antibody, Tm4sf4 antibody
- Background
- TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.
- Molecular Weight
- 21 kDa (MW of target protein)
-