CYP2D6 antibody (Middle Region)

Catalog No. ABIN636070

Product Details anti-CYP2D6 Antibody

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP2D6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP2 D6 antibody was raised against the middle region of CYP2 6

Purification: Affinity purified

Immunogen: CYP2 D6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP2D6 Blocking Peptide, catalog no. 33R-2258, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP2D6

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Alternative Name: CYP2D6 (CYP2D6 Products)

Synonyms: CPD6 antibody, CYP2D antibody, CYP2D7AP antibody, CYP2D7BP antibody, CYP2D7P2 antibody, CYP2D8P2 antibody, CYP2DL1 antibody, CYPIID6 antibody, P450-DB1 antibody, P450C2D antibody, P450DB1 antibody, CYP2D42 antibody, MGC64445 antibody, cyp2d2 antibody, cyp2d6-a antibody, CYP2D6 antibody, cytochrome P450 family 2 subfamily D member 6 antibody, cytochrome P450, family 2, subfamily D, polypeptide 6 antibody, cytochrome 2D6 antibody, cytochrome P450 family 2 subfamily D member 6 S homeolog antibody, cytochrome P450 2D6 antibody, cytochrome P450 2D6-like antibody, CYP2D6 antibody, cyp2d6-b antibody, cyp2d6.S antibody, cyp2d6 antibody, LOC100988273 antibody

Background: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molecular Weight: 56 kDa (MW of target protein)