CYP2E1 antibody (C-Term)
-
- Target See all CYP2E1 Antibodies
- CYP2E1 (Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2E1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP2 E1 antibody was raised against the C terminal of CYP2 1
- Purification
- Affinity purified
- Immunogen
- CYP2 E1 antibody was raised using the C terminal of CYP2 1 corresponding to a region with amino acids QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL
- Top Product
- Discover our top product CYP2E1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP2E1 Blocking Peptide, catalog no. 33R-7522, is also available for use as a blocking control in assays to test for specificity of this CYP2E1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2E1 (Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1))
- Alternative Name
- CYP2E1 (CYP2E1 Products)
- Synonyms
- CYP2E1 antibody, CYP2E antibody, CYPIIE1 antibody, CPE1 antibody, P450-J antibody, P450C2E antibody, Cyp2e antibody, cytochrome P450, family 2, subfamily E, polypeptide 1 antibody, cytochrome P450 2E1 antibody, cytochrome P450 2E1-like antibody, cytochrome P450 family 2 subfamily E member 1 antibody, cytochrome P450, family 2, subfamily e, polypeptide 1 antibody, CYP2E1 antibody, PTRG_07411 antibody, LOC100342572 antibody, LOC100727914 antibody, LOC101843716 antibody, Cyp2e1 antibody
- Background
- CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation.
- Molecular Weight
- 54 kDa (MW of target protein)
-