CYP2A7 antibody (Middle Region)

Catalog No. ABIN636075

Product Details anti-CYP2A7 Antibody

Target: CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP2A7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP2 A7 antibody was raised against the middle region of CYP2 7

Purification: Affinity purified

Immunogen: CYP2 A7 antibody was raised using the middle region of CYP2 7 corresponding to a region with amino acids KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP2A7 Blocking Peptide, catalog no. 33R-4704, is also available for use as a blocking control in assays to test for specificity of this CYP2A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP2A7

Target: CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))

Alternative Name: CYP2A7 (CYP2A7 Products)

Synonyms: CPA7 antibody, CPAD antibody, CYP2A antibody, CYPIIA7 antibody, P450-IIA4 antibody, cytochrome P450 family 2 subfamily A member 7 antibody, CYP2A7 antibody

Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molecular Weight: 56 kDa (MW of target protein)