CYP20A1 antibody (N-Term)

Catalog No. ABIN636079

Product Details anti-CYP20A1 Antibody

Target: CYP20A1 (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP20A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP20 A1 antibody was raised against the N terminal of CYP20 1

Purification: Affinity purified

Immunogen: CYP20 A1 antibody was raised using the N terminal of CYP20 1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP20A1 Blocking Peptide, catalog no. 33R-4185, is also available for use as a blocking control in assays to test for specificity of this CYP20A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP20A1

Target: CYP20A1 (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1))

Alternative Name: CYP20A1 (CYP20A1 Products)

Synonyms: CYP-M antibody, A930011N14Rik antibody, Cypm antibody, wu:fa10c06 antibody, zgc:63986 antibody, cyp-m antibody, cytochrome P450 family 20 subfamily A member 1 antibody, cytochrome P450, family 20, subfamily a, polypeptide 1 antibody, cytochrome P450, family 20, subfamily A, polypeptide 1 antibody, cytochrome P450 family 20 subfamily A member 1 L homeolog antibody, CYP20A1 antibody, Cyp20a1 antibody, cyp20a1 antibody, cyp20a1.L antibody

Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molecular Weight: 52 kDa (MW of target protein)