Insulin Receptor antibody (Middle Region)
-
- Target See all Insulin Receptor (INSR) Antibodies
- Insulin Receptor (INSR)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Insulin Receptor antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- INSR antibody was raised against the middle region of INSR
- Purification
- Affinity purified
- Immunogen
- INSR antibody was raised using the middle region of INSR corresponding to a region with amino acids ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR
- Top Product
- Discover our top product INSR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
INSR Blocking Peptide, catalog no. 33R-2612, is also available for use as a blocking control in assays to test for specificity of this INSR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Insulin Receptor (INSR)
- Alternative Name
- INSR (INSR Products)
- Synonyms
- CD220 antibody, HHF5 antibody, 4932439J01Rik antibody, D630014A15Rik antibody, IR antibody, IR-A antibody, IR-B antibody, 18402 antibody, CG18402 antibody, DIHR antibody, DILR antibody, DIR antibody, DIRH antibody, DIRbeta antibody, DInR antibody, DInr antibody, Dir-a antibody, Dir-b antibody, Dmel\\CG18402 antibody, INR antibody, INS antibody, Inr antibody, Inr-alpha antibody, Inr-beta antibody, InsR antibody, dINR antibody, dIR antibody, dIRH antibody, dInR antibody, dInr antibody, dInsR antibody, dinr antibody, dir antibody, er10 antibody, inr antibody, insulin/insulin-like growth factor receptor antibody, l(3)05545 antibody, l(3)93Dj antibody, l(3)er10 antibody, lnR antibody, ir-A antibody, CTK-1 antibody, ir antibody, INSR antibody, NV14476 antibody, cd220 antibody, hhf5 antibody, insulin receptor antibody, Insulin-like receptor antibody, insulin receptor L homeolog antibody, INSR antibody, Insr antibody, InR antibody, LOC100122567 antibody, LOC100451802 antibody, insr.L antibody
- Background
- This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin.
- Molecular Weight
- 154 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, RTK Signaling, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity
-