Insulin Receptor antibody (Middle Region)

Catalog No. ABIN636083

Product Details anti-Insulin Receptor Antibody

Target: Insulin Receptor (INSR)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Insulin Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: INSR antibody was raised against the middle region of INSR

Purification: Affinity purified

Immunogen: INSR antibody was raised using the middle region of INSR corresponding to a region with amino acids ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INSR Blocking Peptide, catalog no. 33R-2612, is also available for use as a blocking control in assays to test for specificity of this INSR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Insulin Receptor

Target: Insulin Receptor (INSR)

Alternative Name: INSR (INSR Products)

Synonyms: CD220 antibody, HHF5 antibody, 4932439J01Rik antibody, D630014A15Rik antibody, IR antibody, IR-A antibody, IR-B antibody, 18402 antibody, CG18402 antibody, DIHR antibody, DILR antibody, DIR antibody, DIRH antibody, DIRbeta antibody, DInR antibody, DInr antibody, Dir-a antibody, Dir-b antibody, Dmel\\CG18402 antibody, INR antibody, INS antibody, Inr antibody, Inr-alpha antibody, Inr-beta antibody, InsR antibody, dINR antibody, dIR antibody, dIRH antibody, dInR antibody, dInr antibody, dInsR antibody, dinr antibody, dir antibody, er10 antibody, inr antibody, insulin/insulin-like growth factor receptor antibody, l(3)05545 antibody, l(3)93Dj antibody, l(3)er10 antibody, lnR antibody, ir-A antibody, CTK-1 antibody, ir antibody, INSR antibody, NV14476 antibody, cd220 antibody, hhf5 antibody, insulin receptor antibody, Insulin-like receptor antibody, insulin receptor L homeolog antibody, INSR antibody, Insr antibody, InR antibody, LOC100122567 antibody, LOC100451802 antibody, insr.L antibody

Background: This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin.

Molecular Weight: 154 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, RTK Signaling, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity