-
- Target See all STS Antibodies
- STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- STS antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY
- Top Product
- Discover our top product STS Primary Antibody
-
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 235-583) antibody
STS Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 1-583) antibodySTS Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 51-150) antibodySTS Reactivity: Human WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 248-350) antibodySTS Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 1-583) antibodySTS Reactivity: Human WB Host: Mouse Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) antibodySTS Reactivity: Human WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (Internal Region) antibodyVerified STS Reactivity: Human WB, ELISA Host: Goat Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 501-550) antibodySTS Reactivity: Human, Rat, Cow, Horse, Pig WB Host: Rabbit Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (C-Term) antibodySTS Reactivity: Human, Rat, Cow, Horse, Guinea Pig WB Host: Rabbit Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 488-517), (C-Term) antibodySTS Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STS Blocking Peptide, catalog no. 33R-2652, is also available for use as a blocking control in assays to test for specificity of this STS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))
- Alternative Name
- STS (STS Products)
- Synonyms
- ARSC antibody, ARSC1 antibody, ASC antibody, ES antibody, SSDD antibody, XLI antibody, abcg2 antibody, ArsC antibody, Sts antibody, si:ch211-271l9.1 antibody, steroid sulfatase antibody, breast cancer resistance protein antibody, Steryl-sulfatase antibody, steryl-sulfatase antibody, steroid sulfatase (microsomal), isozyme S antibody, STS antibody, abcg2 antibody, Sts antibody, Plav_0360 antibody, Psta_3963 antibody, Runsl_5106 antibody, LOC100712701 antibody, sts antibody
- Background
- STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis.
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-
You are here:
