SLC22A7 antibody
-
- Target See all SLC22A7 Antibodies
- SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A7 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- SLC22 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE
- Top Product
- Discover our top product SLC22A7 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A7 Blocking Peptide, catalog no. 33R-5435, is also available for use as a blocking control in assays to test for specificity of this SLC22A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))
- Alternative Name
- SLC22A7 (SLC22A7 Products)
- Synonyms
- NLT antibody, OAT2 antibody, Oat2 antibody, oat2 antibody, nlt antibody, slc22a7 antibody, im:6901703 antibody, im:7155670 antibody, oat2a antibody, zgc:162334 antibody, oat2e antibody, slc22a7b antibody, zgc:63958 antibody, solute carrier family 22 member 7 antibody, solute carrier family 22 (organic anion transporter), member 7 antibody, solute carrier family 22 (organic anion transporter), member 7 L homeolog antibody, solute carrier family 22 (organic anion transporter), member 7a antibody, solute carrier family 22 (organic anion transporter), member 7b, tandem duplicate 1 antibody, SLC22A7 antibody, Slc22a7 antibody, slc22a7.L antibody, slc22a7a antibody, slc22a7b.1 antibody
- Background
- SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.
- Molecular Weight
- 26 kDa (MW of target protein)
-