LRFN5 antibody (Middle Region)

Catalog No. ABIN636112

Product Details anti-LRFN5 Antibody

Target: LRFN5 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRFN5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRFN5 antibody was raised against the middle region of LRFN5

Purification: Affinity purified

Immunogen: LRFN5 antibody was raised using the middle region of LRFN5 corresponding to a region with amino acids PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRFN5 Blocking Peptide, catalog no. 33R-7195, is also available for use as a blocking control in assays to test for specificity of this LRFN5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRFN5

Target: LRFN5 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5))

Alternative Name: LRFN5 (LRFN5 Products)

Background: The specific function of LRFN5 is not yet known.

Molecular Weight: 79 kDa (MW of target protein)