TNFRSF21 antibody (N-Term)

Catalog No. ABIN636122

Product Details anti-TNFRSF21 Antibody

Target: TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNFRSF21 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TNFRSF21 antibody was raised against the N terminal of TNFRSF21

Purification: Affinity purified

Immunogen: TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNFRSF21 Blocking Peptide, catalog no. 33R-9334, is also available for use as a blocking control in assays to test for specificity of this TNFRSF21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFRSF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNFRSF21

Target: TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))

Alternative Name: TNFRSF21 (TNFRSF21 Products)

Synonyms: TNFRSF21 antibody, tnfrsf21 antibody, MGC146356 antibody, BM-018 antibody, CD358 antibody, DR6 antibody, AA959878 antibody, R74815 antibody, TR7 antibody, dr6 antibody, im:6795346 antibody, wu:fa55e01 antibody, wu:fb02e11 antibody, wu:fc29a09 antibody, wu:fi27h08 antibody, TNF receptor superfamily member 21 antibody, tumor necrosis factor receptor superfamily member 21 antibody, tumor necrosis factor receptor superfamily, member 21 antibody, TNFRSF21 antibody, tnfrsf21 antibody, Tnfrsf21 antibody

Background: TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activateNF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction ofTNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha