DDT antibody

Catalog No. ABIN6719479

Product Details anti-DDT Antibody

Target: DDT (D-Dopachrome Tautomerase (DDT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDT antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for DDT detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EFLTKELALG QDRILIRFFP LESWQIGKIG TVMTFL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for DDT detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human DDT (EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL).

Isotype: IgG

Application Details

Application Notes:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Comment:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for DDT

Target: DDT (D-Dopachrome Tautomerase (DDT))

Alternative Name: DDT (DDT Products)

Synonyms: ddt-b antibody, zgc:86714 antibody, wu:fb49f11 antibody, C78655 antibody, DDT antibody, ddt antibody, ddt-a antibody, DDCT antibody, D-dopachrome tautomerase L homeolog antibody, D-dopachrome tautomerase antibody, D-dopachrome tautomerase S homeolog antibody, ddt.L antibody, DDT antibody, ddt antibody, Ddt antibody, ddt.S antibody

Background:

Synonyms: D-dopachrome decarboxylase, D-dopachrome tautomerase, Phenylpyruvate tautomerase II, DDT

Background: DDT, D-dopachrome tautomerization, converts D-dopachrome into 5, 6-dihydroxyindole. Northern blot analysis revealed that DDT was expressed as a 0.6-kb mRNA in all tissues tested, with the strongest expression in liver. The DDT gene in human and mouse is identical in exon structure to the MIF gene. Both genes have 2 introns that are located at equivalent positions, relative to a 2-fold repeat in protein structure.the genes for DDT and MIF are closely linked on human chromosome 22 and mouse chromosome 10.

Gene ID: 1652

UniProt: P30046