PRND antibody
-
- Target See all PRND Antibodies
- PRND (Prion Protein 2 (Dublet) (PRND))
- Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRND antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- ATQAANQGEF QKPDNKLHQQ VLWRLVQELC SLKH
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human Doppel (ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH).
- Isotype
- IgG
- Top Product
- Discover our top product PRND Primary Antibody
-
-
- Application Notes
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL
- Comment
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PRND (Prion Protein 2 (Dublet) (PRND))
- Alternative Name
- PRND (PRND Products)
- Synonyms
- PRND antibody, DOPPEL antibody, DPL antibody, PrPLP antibody, dJ1068H6.4 antibody, dpl antibody, AI450264 antibody, Dpl antibody, doppel antibody, prion like protein doppel antibody, PRND antibody, Prnd antibody
- Background
-
Synonyms: Prion-like protein doppel, PrPLP, Prion protein 2, PRND, DPL, UNQ1830/PRO3443
Background: Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.
- Gene ID
- 23627
- Pathways
- Transition Metal Ion Homeostasis
-