Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Prion Protein 2 (Dublet) (PRND) antibody Primary Antibody

PRND Reactivity: Human, Mouse, Rat IHC (p), WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN6719483
$280.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 4 to 6 Business Days
  • Target
    Prion Protein 2 (Dublet) (PRND)
    Reactivity
    Human, Mouse, Rat
    Host
    Rabbit
    • 20
    Clonality
    Polyclonal
    • 20
    Conjugate
    Un-conjugated
    • 6
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
    • 13
    • 7
    • 4
    • 3
    • 2
    Purpose
    Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    ATQAANQGEF QKPDNKLHQQ VLWRLVQELC SLKH
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence of human Doppel (ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH).
    Isotype
    IgG
  • Application Notes

    Application details: Western blot|0.1-0.5&mu,g/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1&mu,g/mL

    Comment

    Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Buffer
    Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Target
    Prion Protein 2 (Dublet) (PRND)
    Alternative Name
    PRND (PRND Antibody Abstract)
    Synonyms
    PRND, DOPPEL, DPL, PrPLP, dJ1068H6.4, dpl, AI450264, Dpl, doppel, prion like protein doppel, PRND, Prnd
    Background

    Synonyms: Prion-like protein doppel, PrPLP, Prion protein 2, PRND, DPL, UNQ1830/PRO3443

    Background: Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.

    Gene ID
    23627
    Pathways
    Transition Metal Ion Homeostasis
You are here:
help Support