ELAVL2 antibody

Catalog No. ABIN6719562

Product Details anti-ELAVL2 Antibody

Target: ELAVL2 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 2 (Hu Antigen B) (ELAVL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELAVL2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for ELAVL2 HuB detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: METQLSNGPT CNNTANGPTT INNNCSSPVD SGNTEDSK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for ELAVL2 HuB detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human ELAVL2 HuB (METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK).

Isotype: IgG

Application Details

Application Notes:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Comment:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ELAVL2

Target: ELAVL2 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 2 (Hu Antigen B) (ELAVL2))

Alternative Name: ELAVL2 (ELAVL2 Products)

Synonyms: ELAVL2 antibody, HEL-N1 antibody, HELN1 antibody, HUB antibody, Hub antibody, mel-N1 antibody, Elav2 antibody, Xel-1 antibody, el-1 antibody, elavl2 antibody, elrB antibody, hel-n1 antibody, heln1 antibody, hub antibody, p45 antibody, zgc:91918 antibody, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B) antibody, ELAV like RNA binding protein 2 antibody, ELAV like neuron-specific RNA binding protein 2 L homeolog antibody, ELAV like neuron-specific RNA binding protein 2 antibody, ELAVL2 antibody, Elavl2 antibody, elavl2.L antibody, elavl2 antibody

Background:

Synonyms: ELAV-like protein 2, ELAV-like neuronal protein 1, Hu-antigen B, HuB, Nervous system-specific RNA-binding protein Hel-N1, ELAVL2, HUB

Background: ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450 superfamily of enzymes, and is commonly known as sterol 27-hydroxylase. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.

Gene ID: 1993

UniProt: Q12926