KCNA2 antibody (C-Term, Intracellular)
-
- Target See all KCNA2 Antibodies
- KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))
-
Binding Specificity
- AA 417-499, C-Term, Intracellular
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNA2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunocytochemistry (ICC)
- Characteristics
- Anti-Kv1.2 (KCNA2) Antibody is directed against an epitope of rat KV1.2. Anti-KV1.2 (KCNA2) Antibody (ABIN7043517, ABIN7044912 and ABIN7044913)) can be used in western blot, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize KV1.2 from human, rat, and mouse samples.
- Purification
- The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Immunogen
-
Immunogen: GST fusion protein
Immunogen Sequence: GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2
- Isotype
- IgG
- Top Product
- Discover our top product KCNA2 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.
- Concentration
- 0.8 mg/mL
- Buffer
- Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- RT,4 °C,-20 °C
- Storage Comment
-
Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.
Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
-
- Target
- KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))
- Alternative Name
- KV1.2 (KCNA2) (KCNA2 Products)
- Synonyms
- KCNA2 antibody, kcna2 antibody, HBK5 antibody, HK4 antibody, HUKIV antibody, KV1.2 antibody, MK2 antibody, NGK1 antibody, RBK2 antibody, Akr6a4 antibody, ENSMUSG00000074335 antibody, Gm10672 antibody, Kca1-2 antibody, Kv1.2 antibody, Mk-2 antibody, BK2 antibody, XSha2 antibody, k(v)1.2 antibody, kcna2-a antibody, kv1.2 antibody, potassium voltage-gated channel subfamily A member 2 antibody, potassium channel, voltage gated shaker related subfamily A, member 1 antibody, potassium voltage-gated channel, shaker-related subfamily, member 2 antibody, potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog antibody, KCNA2 antibody, kcna1 antibody, Kcna2 antibody, LOC100537815 antibody, kcna2.S antibody
- Background
- Alternative names: KV1.2 (KCNA2), Potassium voltage-gated channel subfamily A member 2, RBK2
- Gene ID
- 25468
- NCBI Accession
- NM_004974
- UniProt
- P63142
-