Tissue factor antibody (AA 45-154)

Catalog No. ABIN947845

Product Details anti-Tissue factor Antibody

Target: Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))

Binding Specificity: AA 45-154

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Tissue factor antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Purpose: Mouse monoclonal antibody raised against a partial recombinant F3.

Cross-Reactivity: Human

Immunogen:

immunogen: F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK

Clone: 4G4

Isotype: IgG2a kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: In ascites fluid

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References for anti-Tissue factor antibody (ABIN947845)

Cugno, Marzano, Lorini, Carbonelli, Tedeschi: "Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis." in: PLoS ONE, Vol. 9, Issue 11, pp. e111862, (2014) (PubMed).

Target Details for Tissue factor

Target: Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))

Alternative Name: F3 (F3 Products)

Background: Full Gene Name: coagulation factor III (thromboplastin, tissue factor)
Synonyms: CD142,TF,TFA

Gene ID: 2152

Pathways: Positive Regulation of Endopeptidase Activity, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling