anti-Human Annexin V antibody for Immunohistochemistry

Recommended Annexin V Antibody (supplied by: Log in to see )

Antigen
Annexin A5 (ANXA5) Antibodies
  • anx
  • anx5
  • ANX V
  • anxa5
  • cb989
  • wu:fa98f06
  • wu:fj10f10
  • MGC89158
  • ANX5
  • ENX2
  • PP4
  • RPRGL3
  • Anx5
  • R74653
  • LC5
  • enx2
  • annexin A5
  • annexin A5b
  • Annexin A5
  • annexin A5 L homeolog
  • ANXA5
  • anxa5b
  • anxa5
  • Anxa5
  • anxa5.L
Reactivity
Human
229
79
56
15
8
7
7
7
6
4
3
3
2
2
2
Host
Rabbit
161
96
1
Clonality
Polyclonal
Conjugate
This Annexin V antibody is un-conjugated
26
24
8
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
206
145
104
72
40
30
27
23
8
7
6
4
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4280830
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.0975895 ABIN2471157 IF IP IHC ELISA WB Mouse IgG1 kappa Log in to see 1F4-1A5 0
9.0975895 ABIN3029976 FACS IHC ELISA WB Rabbit Ig Fraction AA 1-30 Log in to see Polyclonal 0
9.0975895 ABIN3028465 IHC ELISA WB Rabbit Ig Fraction AA 262-291 Log in to see Polyclonal 0
9.0975895 ABIN2420983 IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN223081 IP IHC WB Rabbit IgG Log in to see Polyclonal 5
1 ABIN151429 IHC IHC (p) IP SimWes WB Rabbit IgG Log in to see Polyclonal 2
1 ABIN408254 ICC IF IHC (p) IHC WB Rabbit Log in to see Polyclonal 2
1 ABIN1582261 IHC ELISA WB Rabbit C-Term Log in to see Polyclonal 1
1 ABIN1870990 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1077799 ICC IHC WB Rabbit IgG AA 1-320 Log in to see Polyclonal 0
1 ABIN1001773 IP IHC WB Rabbit Log in to see Polyclonal 0
1 ABIN791195 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1582392 IHC ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN5564838 FACS ICC IF IHC PE Rabbit AA 1-320 Log in to see Polyclonal 0
1 ABIN3022451 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5680792 CyTOF ELISA FACS ICC IF IHC WB Mouse IgG1 AA 160-320 Log in to see 3B9B7 0
1 ABIN5680793 CyTOF ELISA FACS ICC IHC WB Mouse IgG1 AA 160-320 Log in to see 3B9F3 0
1 ABIN2201360 IHC WB Rabbit AA 88-102 Log in to see Polyclonal 0
1 ABIN4280831 CyTOF ELISA FACS ICC IHC WB Mouse Log in to see 3B9F3 0
1 ABIN4280832 CyTOF ELISA FACS ICC IF IHC WB Mouse Log in to see 3B9B7 0

General

Antigen Annexin A5 (ANXA5) Antibodies
Reactivity Human
(229), (79), (56), (15), (8), (7), (7), (7), (6), (4), (3), (3), (2), (2), (2)
Host Rabbit
(161), (96), (1)
Clonality
Polyclonal
Conjugate This Annexin V antibody is un-conjugated
(26), (24), (8), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(206), (145), (104), (72), (40), (30), (27), (23), (8), (7), (6), (4), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Annexin V Antibody

Target Details Annexin V Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAG

Target Details Annexin V

Product Details anti-Annexin V Antibody Application Details Handling Images back to top
Antigen
Alternative Name Annexin V (ANXA5 Antibody Abstract)
Background Gene Symbol: ANXA5
Gene ID 308
UniProt P08758
Pathways Apoptosis

Application Details

Product Details anti-Annexin V Antibody Target Details Annexin V Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Annexin V Antibody Target Details Annexin V Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Annexin V Antibody Target Details Annexin V Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Annexin A5 (ANXA5) antibody (ABIN4280830) Immunocytochemistry/Immunofluorescence: Annexin V Antibody [NBP2-38248] - Immunofluor...
Immunohistochemistry (IHC) image for anti-Annexin A5 (ANXA5) antibody (ABIN4280830) Immunohistochemistry: Annexin V Antibody [NBP2-38248] - Staining of human testis show...
Western Blotting (WB) image for anti-Annexin A5 (ANXA5) antibody (ABIN4280830) Western Blot: Annexin V Antibody [NBP2-38248] - Lane 1: Marker [kDa] 230, 130, 95, 72...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Annexin A5 (ANXA5) antibody (ABIN4280830) Immunohistochemistry-Paraffin: Annexin V Antibody - Staining of human testis shows m...