anti-Chimpanzee Caspase 2 antibody for Western Blotting

Recommended Caspase 2 Antibody (supplied by: Log in to see )

Antigen
Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2) Antibodies
  • xCaspase-2
  • Caspase-2
  • ICH-1
  • Nedd2
  • CASP-2
  • ICH1
  • NEDD-2
  • NEDD2
  • PPP1R57
  • ICH-1L/1S
  • ICH1L1S
  • caspase-2-like
  • caspase-2
  • caspase 2
  • caspase 2, apoptosis-related cysteine peptidase
  • LOC100050611
  • xCaspase-2
  • CpipJ_CPIJ008254
  • Casp2
  • LOC100101590
  • CASP2
  • LOC100521118
Epitope
AA 378-409
27
22
14
9
7
5
5
4
4
4
4
3
3
3
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Chimpanzee, Gibbon, Guinea Pig, Human, Monkey, Mouse (Murine), Orang-Utan, Rat (Rattus)
210
91
68
10
7
2
2
2
2
1
1
1
1
Host
Rabbit
159
49
13
Clonality
Polyclonal
Conjugate
This Caspase 2 antibody is un-conjugated
6
6
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
182
101
48
36
18
15
13
12
12
4
4
4
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN2738755
$ 493.17
Plus shipping costs $45.00

General

Antigen Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2) Antibodies
Epitope AA 378-409
(27), (22), (14), (9), (7), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Chimpanzee, Gibbon, Guinea Pig, Human, Monkey, Mouse (Murine), Orang-Utan, Rat (Rattus)
(210), (91), (68), (10), (7), (2), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(159), (49), (13)
Clonality
Polyclonal
Conjugate This Caspase 2 antibody is un-conjugated
(6), (6), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(182), (101), (48), (36), (18), (15), (13), (12), (12), (4), (4), (4), (2), (1)
Supplier Log in to see

Product Details anti-Caspase 2 Antibody

Target Details Caspase 2 Application Details Handling Images
Specificity Human, Mouse, Rat. No cross-reactivity with other proteins.
Purification Immunoaffinity purified
Immunogen Synthetic peptide from the C-terminus of human CASP2 (aa378-409, RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Marmoset, Guinea pig (100%), Galago, Mouse, Ferret, Hamster (97%), Sheep, Rabbit, Opossum, Dog (94%), Cat (91%).

Type of Immunogen: Synthetic peptide
Isotype IgG

Target Details Caspase 2

Product Details anti-Caspase 2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CASP2 / Caspase 2 (CASP2 Antibody Abstract)
Background Name/Gene ID: CASP2
Subfamily: Cysteine C14
Family: Protease

Synonyms: CASP2, CASP-2, Caspase-2, PPP1R57, Protease ICH-1, NEDD-2, Caspase 2, ICH1, NEDD2
Gene ID 835
Pathways Apoptosis, Caspase Cascade in Apoptosis, Neurotrophin Signaling Pathway

Application Details

Product Details anti-Caspase 2 Antibody Target Details Caspase 2 Handling Images back to top
Application Notes Optimal working dilution should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-Caspase 2 Antibody Target Details Caspase 2 Application Details Images back to top
Format Lyophilized
Reconstitution Distilled water
Concentration Lot specific
Buffer Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice avoid freeze thaw cycles
Storage 4 °C,-20 °C
Storage Comment Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.