anti-Chimpanzee Caspase 2 antibody for Western Blotting

Recommended Caspase 2 Antibody (supplied by: Log in to see )

Antigen
Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2) Antibodies
  • xCaspase-2
  • Caspase-2
  • ICH-1
  • Nedd2
  • CASP-2
  • ICH1
  • NEDD-2
  • NEDD2
  • PPP1R57
  • ICH-1L/1S
  • ICH1L1S
  • caspase 2
  • caspase 2 L homeolog
  • caspase-2
  • CASP2
  • casp2.L
  • CpipJ_CPIJ008254
  • Casp2
Epitope
AA 378-409
25
21
13
9
8
6
5
5
4
4
4
4
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Chimpanzee, Gibbon, Guinea Pig, Human, Monkey, Mouse (Murine), Orang-Utan (Pongo abelii), Rat (Rattus)
228
101
74
12
9
2
2
2
2
1
1
1
1
Host
Rabbit
181
43
15
Clonality
Polyclonal
Conjugate
This Caspase 2 antibody is un-conjugated
8
8
4
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
199
107
73
35
20
17
14
13
13
6
4
4
4
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN2738755
$ 493.17
Plus shipping costs $45.00

General

Antigen Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2) Antibodies
Epitope AA 378-409
(25), (21), (13), (9), (8), (6), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Chimpanzee, Gibbon, Guinea Pig, Human, Monkey, Mouse (Murine), Orang-Utan (Pongo abelii), Rat (Rattus)
(228), (101), (74), (12), (9), (2), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(181), (43), (15)
Clonality
Polyclonal
Conjugate This Caspase 2 antibody is un-conjugated
(8), (8), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(199), (107), (73), (35), (20), (17), (14), (13), (13), (6), (4), (4), (4)
Supplier Log in to see

Product Details anti-Caspase 2 Antibody

Target Details Caspase 2 Application Details Handling Images
Specificity Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.
Purification Immunogen affinity purified
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human CASP2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.
Isotype IgG
Plasmids, Primers & others

Target Details Caspase 2

Product Details anti-Caspase 2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name CASP2 / Caspase 2 (CASP2 Antibody Abstract)
Background Name/Gene ID: CASP2
Subfamily: Cysteine C14
Family: Protease

Synonyms: CASP2, CASP-2, Caspase-2, PPP1R57, Protease ICH-1, NEDD-2, Caspase 2, ICH1, NEDD2
Gene ID 835
Pathways Apoptosis, Caspase Cascade in Apoptosis, Neurotrophin Signaling Pathway

Application Details

Product Details anti-Caspase 2 Antibody Target Details Caspase 2 Handling Images back to top
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Target Species of Antibody: Human

Restrictions For Research Use only

Handling

Product Details anti-Caspase 2 Antibody Target Details Caspase 2 Application Details Images back to top
Format Lyophilized
Reconstitution Distilled water
Concentration Lot specific
Buffer Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice avoid freeze thaw cycles
Storage 4 °C,-20 °C
Storage Comment At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.