anti-Gibbon Caspase 2 antibody for Western Blotting

Recommended Caspase 2 Antibody (supplied by: Log in to see )

Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2) Antibodies
  • xCaspase-2
  • Caspase-2
  • ICH-1
  • Nedd2
  • CASP-2
  • ICH1
  • NEDD-2
  • NEDD2
  • PPP1R57
  • ICH-1L/1S
  • ICH1L1S
  • caspase 2
  • caspase 2 L homeolog
  • caspase-2
  • CASP2
  • casp2.L
  • CpipJ_CPIJ008254
  • Casp2
AA 378-409
Chimpanzee, Gibbon, Guinea Pig, Human, Monkey, Mouse (Murine), Orang-Utan (Pongo abelii), Rat (Rattus)
This Caspase 2 antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN2738755
$ 493.17
Plus shipping costs $45.00


Antigen Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2) Antibodies
Epitope AA 378-409
(21), (13), (9), (8), (6), (6), (5), (5), (4), (4), (4), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Chimpanzee, Gibbon, Guinea Pig, Human, Monkey, Mouse (Murine), Orang-Utan (Pongo abelii), Rat (Rattus)
(212), (102), (76), (12), (9), (2), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(183), (25), (15)
Conjugate This Caspase 2 antibody is un-conjugated
(7), (7), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(183), (90), (72), (35), (21), (17), (15), (13), (13), (6), (4), (4), (4)
Supplier Log in to see

Product Details anti-Caspase 2 Antibody

Target Details Caspase 2 Application Details Handling Images
Specificity Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.
Purification Immunogen affinity purified
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human CASP2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.
Isotype IgG
Plasmids, Primers & others

Target Details Caspase 2

Product Details anti-Caspase 2 Antibody Application Details Handling Images back to top
Alternative Name CASP2 / Caspase 2 (CASP2 Antibody Abstract)
Background Name/Gene ID: CASP2
Subfamily: Cysteine C14
Family: Protease

Synonyms: CASP2, CASP-2, Caspase-2, PPP1R57, Protease ICH-1, NEDD-2, Caspase 2, ICH1, NEDD2
Gene ID 835
Pathways Apoptosis, Caspase Cascade in Apoptosis, Neurotrophin Signaling Pathway

Application Details

Product Details anti-Caspase 2 Antibody Target Details Caspase 2 Handling Images back to top
Application Notes Optimal working dilution should be determined by the investigator.

Target Species of Antibody: Human

Restrictions For Research Use only


Product Details anti-Caspase 2 Antibody Target Details Caspase 2 Application Details Images back to top
Format Lyophilized
Reconstitution Distilled water
Concentration Lot specific
Buffer Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice avoid freeze thaw cycles
Storage 4 °C,-20 °C
Storage Comment At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.