anti-Human CD11b antibody for Immunochromatography

Recommended CD11b Antibody (supplied by: Log in to see )

Antigen
Integrin alpha M (ITGAM) Antibodies
  • CD11b/CD18
  • CR3
  • CR3A
  • Cd11b
  • F730045J24Rik
  • Ly-40
  • MAC1
  • Mac-1
  • Mac-1a
  • CD11B
  • MAC-1
  • MAC1A
  • MO1A
  • SLEB6
  • C3bi
  • integrin subunit alpha M
  • integrin alpha M
  • integrin, alpha M (complement component 3 receptor 3 subunit)
  • integrin alpha-M
  • ITGAM
  • Itgam
  • LOC100351865
Epitope
AA 301-451
48
24
21
19
16
15
13
7
6
6
5
5
5
5
4
4
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Reactivity
Human
688
480
177
80
31
19
17
15
13
11
10
9
7
7
5
4
4
4
2
2
Host
Rabbit
505
391
152
16
5
2
Clonality
Polyclonal
Conjugate
This CD11b antibody is un-conjugated
149
123
91
62
19
18
15
15
14
14
14
13
12
11
9
8
7
7
7
6
6
6
6
6
6
4
4
4
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
870
236
228
174
166
138
97
96
95
68
21
21
14
13
12
8
5
4
4
3
3
1
1
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN2295636
$ 614.43
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2292239 IC ELISA WB Mouse AA 623-728 Log in to see 14i174

General

Antigen Integrin alpha M (ITGAM) Antibodies
Epitope AA 301-451
(48), (24), (21), (19), (16), (15), (13), (7), (6), (6), (5), (5), (5), (5), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(688), (480), (177), (80), (31), (19), (17), (15), (13), (11), (10), (9), (7), (7), (5), (4), (4), (4), (2), (2)
Host Rabbit
(505), (391), (152), (16), (5), (2)
Clonality
Polyclonal
Conjugate This CD11b antibody is un-conjugated
(149), (123), (91), (62), (19), (18), (15), (15), (14), (14), (14), (13), (12), (11), (9), (8), (7), (7), (7), (6), (6), (6), (6), (6), (6), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(870), (236), (228), (174), (166), (138), (97), (96), (95), (68), (21), (21), (14), (13), (12), (8), (5), (4), (4), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CD11b Antibody

Target Details CD11b Application Details Handling Images
Sequence MRNKKFELGL EFPNLPYYID GDVKLTQSMA IIRYIADKHN MLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTH PDFMLYDALD VVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIA WPLQGWQATF GGGDHPPKSD GSTSGSGHHH HHHSAGLVPR GSTAIGMKET AAAKFERQHM DSPDLGTLEV LFQGPLGSEF -NTIASKPPRD HVFQVNNFEA LKTIQNQLRE KIFAIEGTQT GSSSSFEHEM SQEGFSAAIT SNGPLLSTVG SYDWAGGVFL YTSKEKSTFI NMTRVDSDMN DAYLGYAAAI ILRNRVQSLV LGAPRYQHIG LVAMFRQNTG MWESNANVKG T
Cross-Reactivity Human
Cross-Reactivity (Details) Calculated cross reactivity: Hu
Characteristics Integrin Alpha M (ITGaM, ITG-AM, CD11b, CD11B, CR3A, MAC-1, MAC1A, MO1A, Complement Component 3 Receptor 3 Subunit)
Purification Purified by immunoaffinity chromatography.
Immunogen ITGaM (Asn301~Thr451), MRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTLEVLFQGPLGSEF-NTIASKPPRD HVFQVNNFEA LKTIQNQLRE KIFAIEGTQT GSSSSFEHEM SQEGFSAAIT SNGPLLSTVG SYDWAGGVFL YTSKEKSTFI NMTRVDSDMN DAYLGYAAAI ILRNRVQSLV LGAPRYQHIG LVAMFRQNTG MWESNANVKG T
Isotype IgG

Target Details CD11b

Product Details anti-CD11b Antibody Application Details Handling Images back to top
Antigen
Alternative Name Integrin alpha M (ITGAM Antibody Abstract)
Pathways Apoptosis, Activation of Innate immune Response, Toll-Like Receptors Cascades, Activated T Cell Proliferation

Application Details

Product Details anti-CD11b Antibody Target Details CD11b Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-CD11b Antibody Target Details CD11b Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C