anti-Mouse (Murine) Lamin A/C antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Lamin A/C Antibody (supplied by: Log in to see )

Antigen
Lamin A/C (LMNA) Antibodies
  • CDCD1
  • CDDC
  • CMD1A
  • CMT2B1
  • EMD2
  • FPL
  • FPLD
  • FPLD2
  • HGPS
  • IDC
  • LDP1
  • LFP
  • LGMD1B
  • LMN1
  • LMNC
  • LMNL1
  • PRO1
  • Dhe
  • 2459
  • 74/76
  • CG6944
  • D5
  • DM[[O]]
  • Dm
  • Dm(0)
  • Dm0
  • Dm1
  • Dm2
  • DmLamin
  • DmO
  • Dm[[0]]
  • Dm[[1]]
  • Dm[[2]]
  • Dm[[mit]]
  • Dm[[o]]
  • Dmel\\CG6944
  • Dmo
  • LAM
  • Lam Dm[[0]]
  • Lam(Dm0)
  • LamDm[[0]]
  • LamDm[[o]]
  • Lam[[Dm0]]
  • Lamin Dm[[0]]
  • jf27
  • l(2)04643
  • l(2)25Ec
  • l(2)gdh-7
  • l(2)gdh7
  • l(2)jf27
  • lam
  • lamDm0
  • lamDm[[0]]
  • lamin
  • lamin Dm0
  • lamin Dm[[0]]
  • misg
  • nlam
  • cb948
  • fk66d12
  • wu:fk66d12
  • lmna-A
  • fpl
  • idc
  • lfp
  • cddc
  • emd2
  • fpld
  • hgps
  • ldp1
  • lmn1
  • lmnc
  • pro1
  • cdcd1
  • cmd1a
  • cmt2b1
  • lgmd1b
  • Lamin-A
  • lamin-L(III)-like
  • lamin A/C
  • lamin A
  • Lamin
  • lamin A/C L homeolog
  • lamin-L(III)-like
  • LMNA
  • Lmna
  • Lam
  • lmna
  • lmna.L
  • LMINA
Reactivity
Human, Mouse (Murine), Rat (Rattus)
443
272
236
105
54
51
24
21
15
10
8
7
5
4
3
3
3
2
1
1
1
Host
Rabbit
231
219
5
1
Clonality
Polyclonal
Conjugate
This Lamin A/C antibody is un-conjugated
13
12
10
7
7
7
7
6
6
6
6
6
6
6
5
5
4
4
4
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
404
209
199
163
119
113
78
74
56
17
14
11
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4329984
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.981754 ABIN218314 IHC IHC (p) WB Rabbit IgG AA 249-266 Log in to see Polyclonal 0
12.981754 ABIN291872 IF IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
12.981754 ABIN4329987 ELISA IHC IHC (p) WB Mouse IgG1 Log in to see 4E7 0
12.981754 ABIN1108014 IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
12.981754 ABIN4329985 CyTOF FACS ICC IF IHC IHC (fro) IHC (p) WB Mouse IgG3 AA 598-611 Log in to see 133A2 0
12.981754 ABIN615033 IHC (p) WB Rabbit N-Term Log in to see Polyclonal 0
12.981754 ABIN4330011 ICC IF IHC IHC (p) IP WB Rabbit IgG Center Log in to see Polyclonal 0
12.981754 ABIN4330010 ICC IF IHC IHC (p) IP WB Rabbit IgG Center Log in to see Polyclonal 0
12.981754 ABIN499041 IHC (p) WB Rabbit Log in to see Polyclonal 0
1 ABIN3043295 ICC IHC (p) WB Rabbit IgG AA 481-646 Log in to see Polyclonal 2
1 ABIN3043695 ICC IHC (p) WB Rabbit IgG AA 455-469, C-Term Log in to see Polyclonal 2
1 ABIN112042 FACS IHC (fro) IF IHC (p) WB Mouse IgG3 Log in to see 133A2 12
1 ABIN2854942 ICC IF IP IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN2856820 IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN2854943 ICC IF IP IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN372392 IF IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN108550 FACS ICC IF IHC (fro) IHC (p) IP WB Mouse IgG3 kappa AA 598-611 Log in to see 133A2 2
1 ABIN959428 FACS ICC IHC IHC (fro) IHC (p) WB Mouse IgG3 AA 598-611 Log in to see 133A2 0
1 ABIN2879093 ELISA IHC IHC (p) WB Rabbit IgG AA 181-230, Cleaved-Asp230 Log in to see Polyclonal 0
1 ABIN2879094 ELISA IHC IHC (p) WB Rabbit IgG AA 212-261, Cleaved-Asp230 Log in to see Polyclonal 0

General

Antigen Lamin A/C (LMNA) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(443), (272), (236), (105), (54), (51), (24), (21), (15), (10), (8), (7), (5), (4), (3), (3), (3), (2), (1), (1), (1)
Host Rabbit
(231), (219), (5), (1)
Clonality
Polyclonal
Conjugate This Lamin A/C antibody is un-conjugated
(13), (12), (10), (7), (7), (7), (7), (6), (6), (6), (6), (6), (6), (6), (5), (5), (4), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(404), (209), (199), (163), (119), (113), (78), (74), (56), (17), (14), (11), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-Lamin A/C Antibody

Target Details Lamin A/C Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRE
Isotype IgG
Plasmids, Primers & others

Target Details Lamin A/C

Product Details anti-Lamin A/C Antibody Application Details Handling Images back to top
Antigen
Alternative Name Lamin A (LMNA Antibody Abstract)
Background Gene Symbol: LMNA
Molecular Weight Theoretical MW: 74 kDa
Gene ID 4000
UniProt P02545
Pathways Apoptosis, Caspase Cascade in Apoptosis, ER-Nucleus Signaling, Protein targeting to Nucleus

Application Details

Product Details anti-Lamin A/C Antibody Target Details Lamin A/C Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Lamin A/C Antibody Target Details Lamin A/C Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Lamin A/C Antibody Target Details Lamin A/C Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Lamin A/C (LMNA) antibody (ABIN4329984) Western Blot: Lamin A Antibody [NBP1-85550] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Immunofluorescence (IF) image for anti-Lamin A/C (LMNA) antibody (ABIN4329984) Immunocytochemistry/Immunofluorescence: Lamin A Antibody [NBP1-85550] - Staining of h...
Western Blotting (WB) image for anti-Lamin A/C (LMNA) antibody (ABIN4329984) Western Blot: Lamin A Antibody [NBP1-85550] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Lamin A/C (LMNA) antibody (ABIN4329984) Immunohistochemistry-Paraffin: Lamin A Antibody [NBP1-85550] - Staining of human epid...