anti-Human Chromosome 17 Open Reading Frame 37 antibody for Immunocytochemistry

Recommended Chromosome 17 Open Reading Frame 37 Antibody (supplied by: Log in to see )

Antigen
Chromosome 17 Open Reading Frame 37 (C17orf37) Antibodies
  • C17orf37
  • C35
  • ORB3
  • RDX12
  • XTP4
  • C19H17orf37
  • 1810046J19Rik
  • AI463380
  • Rdx12
  • migration and invasion enhancer 1
  • migration and invasion enhancer 1 S homeolog
  • mien1
  • mien1.S
  • MIEN1
  • Mien1
Reactivity
Human
88
36
35
6
3
2
Host
Rabbit
47
41
Clonality
Polyclonal
Conjugate
Un-conjugated
6
6
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
70
21
13
13
11
7
6
6
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4366479
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
-12.8413315 ABIN6247833 ICC IF IHC WB Mouse IgG2b Log in to see OTI2D5 0

General

Antigen Chromosome 17 Open Reading Frame 37 (C17orf37) Antibodies
Reactivity Human
(88), (36), (35), (6), (3), (2)
Host Rabbit
(47), (41)
Clonality
Polyclonal
Conjugate Un-conjugated
(6), (6), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(70), (21), (13), (13), (11), (7), (6), (6), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name XTP4 (C17orf37 Antibody Abstract)
Background Gene Symbol: MIEN1
Gene ID 84299
UniProt Q9BRT3
Pathways Cell RedoxHomeostasis

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Chromosome 17 Open Reading Frame 37 (C17orf37) antibody (ABIN4366479) Immunohistochemistry-Paraffin: XTP4 Antibody - Staining of human testis shows modera...