anti-Rat (Rattus) Endoplasmic Reticulum Protein 44 antibody for Western Blotting

Recommended Endoplasmic Reticulum Protein 44 Antibody (supplied by: Log in to see )

Antigen
Endoplasmic Reticulum Protein 44 (ERP44) Antibodies
  • PDIA10
  • TXNDC4
  • 1110001E24Rik
  • AI849526
  • AL033348
  • Txndc4
  • BWK4
  • txndc4
  • zgc:77883
  • endoplasmic reticulum protein 44
  • ERP44
  • Erp44
  • erp44
Reactivity
Human, Mouse (Murine), Rat (Rattus)
79
22
13
7
5
5
4
4
4
3
3
3
3
3
2
1
1
Host
Rabbit
53
18
10
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
Application
Western Blotting (WB)
56
39
31
26
10
6
3
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN632154
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
4.727556 ABIN2787804 WB Rabbit Middle Region Log in to see Polyclonal 1
4.727556 ABIN6569712 WB Rabbit IgG Log in to see Polyclonal 0
4.727556 ABIN2560620 ELISA WB Goat IgG Internal Region Log in to see Polyclonal 0
4.727556 ABIN6716603 WB Rabbit Log in to see Polyclonal 0
4.727556 ABIN6291618 WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN297825 ELISA WB Goat AA 168-180 Log in to see Polyclonal 0
4 ABIN470327 WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN2927686 ELISA IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1085659 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Endoplasmic Reticulum Protein 44 (ERP44) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(79), (22), (13), (7), (5), (5), (4), (4), (4), (3), (3), (3), (3), (3), (2), (1), (1)
Host Rabbit
(53), (18), (10)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(56), (39), (31), (26), (10), (6), (3), (2)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Purification Affinity purified
Immunogen TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name TXNDC4 (ERP44 Antibody Abstract)
Background TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
Molecular Weight 45 kDa (MW of target protein)
Pathways Cell RedoxHomeostasis

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TXNDC4 Blocking Peptide, catalog no. 33R-5025, is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Endoplasmic Reticulum Protein 44 (ERP44) antibody (ABIN632154) TXNDC4 antibody used at 1 ug/ml to detect target protein.