anti-Human SH2B2 antibody for Western Blotting

Recommended SH2B2 Antibody (supplied by: Log in to see )

Antigen
SH2B Adaptor Protein 2 (SH2B2) Antibodies
  • APS
  • Aps
  • SH2B adaptor protein 2
  • SH2B2
  • Sh2b2
Reactivity
Human
12
11
11
1
1
Host
Rabbit
14
1
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
11
10
6
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4353230
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0625389 ABIN1852148 ELISA WB Rabbit Internal Region Log in to see Polyclonal 0
1 ABIN604325 WB Goat IgG AA 620-632 Log in to see Polyclonal 0
1 ABIN6256908 ELISA ICC IF WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6103541 ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN229575 WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN5514505 WB Rabbit Middle Region Log in to see Polyclonal 0
1 ABIN5514506 WB Rabbit Middle Region Log in to see Polyclonal 0
1 ABIN1579483 ELISA WB Rabbit Internal Region Log in to see Polyclonal 0

General

Antigen SH2B Adaptor Protein 2 (SH2B2) Antibodies
Reactivity Human
(12), (11), (11), (1), (1)
Host Rabbit
(14), (1)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(11), (10), (6), (1), (1)
Supplier Log in to see

Product Details anti-SH2B2 Antibody

Target Details SH2B2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD
Isotype IgG
Plasmids, Primers & others

Target Details SH2B2

Product Details anti-SH2B2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SH2B2 (SH2B2 Antibody Abstract)
Background Gene Symbol: SH2B2
Gene ID 10603
Pathways Carbohydrate Homeostasis, Brown Fat Cell Differentiation

Application Details

Product Details anti-SH2B2 Antibody Target Details SH2B2 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SH2B2 Antibody Target Details SH2B2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SH2B2 Antibody Target Details SH2B2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SH2B Adaptor Protein 2 (SH2B2) antibody (ABIN4353230) Immunohistochemistry-Paraffin: SH2B2 Antibody [NBP2-13305] - Staining of human prosta...
Immunofluorescence (IF) image for anti-SH2B Adaptor Protein 2 (SH2B2) antibody (ABIN4353230) Immunocytochemistry/Immunofluorescence: SH2B2 Antibody [NBP2-13305] - Staining of hum...
Western Blotting (WB) image for anti-SH2B Adaptor Protein 2 (SH2B2) antibody (ABIN4353230) Western Blot: SH2B2 Antibody [NBP2-13305] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...