anti-Human Laminin alpha 5 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Laminin alpha 5 Antibody (supplied by: Log in to see )

Antigen
Laminin, alpha 5 (LAMA5) Antibodies
  • cb402
  • sb:cb402
  • im:7138247
  • wu:fb81a10
  • AA408760
  • AA408762
  • AI853660
  • [a]5
  • laminin-511
  • mKIAA0533
  • laminin subunit alpha 5
  • laminin, alpha 5
  • LAMA5
  • lama5
  • Lama5
Reactivity
Human
64
36
14
Host
Mouse
48
14
11
Clonality
Monoclonal
Conjugate
This Laminin alpha 5 antibody is un-conjugated
4
4
3
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
38
30
21
15
11
9
7
3
3
3
3
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4330115
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7 ABIN5650047 IHC (p) WB Mouse IgG1 Log in to see CL3118 0
4 ABIN2890002 ELISA IHC IHC (p) Rabbit IgG AA 2381-2430 Log in to see Polyclonal 0
4 ABIN737451 IF (p) IHC (p) Rabbit IgG AA 350-400 Log in to see Polyclonal 0
4 ABIN5957135 ELISA IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2887692 IHC IHC (p) WB Rabbit AA 2371-2420 Log in to see Polyclonal 0
1 ABIN737460 IHC (p) HRP Rabbit IgG AA 350-400 Log in to see Polyclonal 0
1 ABIN737453 IHC (p) Biotin Rabbit IgG AA 350-400 Log in to see Polyclonal 0
1 ABIN2624717 IHC IHC (p) IP WB Rabbit Internal Region Log in to see Polyclonal 0
1 ABIN1862834 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Laminin, alpha 5 (LAMA5) Antibodies
Reactivity Human
(64), (36), (14)
Host Mouse
(48), (14), (11)
Clonality (Clone)
Monoclonal   ( )
Conjugate This Laminin alpha 5 antibody is un-conjugated
(4), (4), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(38), (30), (21), (15), (11), (9), (7), (3), (3), (3), (3), (1)
Supplier Log in to see

Product Details anti-Laminin alpha 5 Antibody

Target Details Laminin alpha 5 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Protein A purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LNLSSIILDVNQDRLTQRAIEASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQQRLGLVWAAL
Clone CL3118
Isotype IgG1
Plasmids, Primers & others

Target Details Laminin alpha 5

Product Details anti-Laminin alpha 5 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Laminin alpha 5 (LAMA5 Antibody Abstract)
Background Gene Symbol: LAMA5
Gene ID 3911
UniProt O15230
Pathways Cell-Cell Junction Organization

Application Details

Product Details anti-Laminin alpha 5 Antibody Target Details Laminin alpha 5 Handling Images back to top
Application Notes Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Laminin alpha 5 Antibody Target Details Laminin alpha 5 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Laminin alpha 5 Antibody Target Details Laminin alpha 5 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of hu...
Western Blotting (WB) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Western Blot: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Lane 1: Marker [kDa] 4...
Immunohistochemistry (IHC) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Staining of hu...
Western Blotting (WB) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Western Blot: Laminin alpha 5 Antibody (CL3118) [NBP2-42391] - Lane 1: Marker [kDa] 4...
Western Blotting (WB) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Western Blot: Laminin alpha 5 Antibody (CL3118) - Analysis of purified human recombi...
Western Blotting (WB) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Western Blot: Laminin alpha 5 Antibody (CL3118) - Analysis in human placenta tissue.
Western Blotting (WB) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Western Blot: Laminin alpha 5 Antibody (CL3118) - Analysis in Caco-2 cells transfect...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) - Staining in human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Laminin, alpha 5 (LAMA5) antibody (ABIN4330115) Immunohistochemistry-Paraffin: Laminin alpha 5 Antibody (CL3118) - Staining of human...