anti-Mouse (Murine) PARD3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PARD3 Antibody

Antigen
Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) Antibodies
  • ASIP
  • Baz
  • PAR3
  • PAR3alpha
  • PARD-3
  • PARD3A
  • SE2-5L16
  • SE2-5LT1
  • SE2-5T2
  • Par3
  • AA960621
  • AI256638
  • D8Ertd580e
  • PAR-3
  • Pard3a
  • asip
  • bazooka
  • par-3
  • par3
  • pard3
  • par-3 family cell polarity regulator
  • partitioning defective 3 homolog
  • par-3 family cell polarity regulator alpha, b
  • par-3 family cell polarity regulator S homeolog
  • PARD3
  • Pard3
  • LOC100551156
  • LOC100473914
  • pard3
  • pard3ab
  • pard3.S
Reactivity
Human, Mouse (Murine)
77
57
46
3
2
2
1
1
Host
Rabbit
75
5
Clonality
Polyclonal
Conjugate
This PARD3 antibody is un-conjugated
4
4
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes)
49
36
18
13
13
9
4
4
3
3
2
1
1
Options

Available images

Catalog No. ABIN4343686
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
11.786455 ABIN681718 IF (p) IHC (p) Rabbit IgG Polyclonal 0
10 ABIN5537264 FACS IHC (p) WB Rabbit Ig Fraction AA 1329-1356, C-Term Polyclonal 0
4 ABIN2878854 ELISA IF IHC IHC (p) WB Rabbit IgG AA 1141-1190 Polyclonal 0
4 ABIN5955605 ELISA IF IHC (p) WB Rabbit IgG C-Term Polyclonal 0
4 ABIN1737860 IF IHC (p) ELISA WB Rabbit IgG Polyclonal 0
1 ABIN681727 IHC (p) HRP Rabbit IgG Polyclonal 0
1 ABIN1810813 FACS IHC IHC (p) WB Rabbit AA 1329-1356 Polyclonal 0
1 ABIN681720 IHC (p) Biotin Rabbit IgG Polyclonal 0

General

Antigen Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) Antibodies
Reactivity Human, Mouse (Murine)
(77), (57), (46), (3), (2), (2), (1), (1)
Host Rabbit
(75), (5)
Clonality
Polyclonal
Conjugate This PARD3 antibody is un-conjugated
(4), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes)
(49), (36), (18), (13), (13), (9), (4), (4), (3), (3), (2), (1), (1)
Pubmed 3 references available
Supplier

Product Details anti-PARD3 Antibody

Target Details PARD3 Application Details Handling References for anti-PARD3 antibody (ABIN4343686) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR
Isotype IgG
Plasmids, Primers & others

Target Details PARD3

Product Details anti-PARD3 Antibody Application Details Handling References for anti-PARD3 antibody (ABIN4343686) Images back to top
Antigen
Alternative Name PARD3/Par3 (PARD3 Antibody Abstract)
Background Gene Symbol: PARD3
Gene ID 56288
Pathways Cell-Cell Junction Organization

Application Details

Product Details anti-PARD3 Antibody Target Details PARD3 Handling References for anti-PARD3 antibody (ABIN4343686) Images back to top
Application Notes Simple Western 1:1000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PARD3 Antibody Target Details PARD3 Application Details References for anti-PARD3 antibody (ABIN4343686) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PARD3 antibody (ABIN4343686)

Product Details anti-PARD3 Antibody Target Details PARD3 Application Details Handling Images back to top
Product cited in:

Tuccilli, Baldini, Arlot-Bonnemains, Chesnel, Sorrenti, De Vito, DArmiento, Antonelli, Fallahi, Watutantrige, Tartaglia, Barollo, Mian, Arcieri, Mascagni, Pironi, Bononi, Vergine, Monti, Filippini et al.: "Expression and prognostic value of the cell polarity PAR complex members in thyroid cancer. ..." in: International journal of oncology, 2017

Whiteman, Fan, Harder, Walton, Liu, Soofi, Fogg, Hershenson, Dressler, Deutsch, Gumucio, Margolis: "Crumbs3 is essential for proper epithelial development and viability." in: Molecular and cellular biology, Vol. 34, Issue 1, pp. 43-56, 2013 (Sample species: Mouse (Murine)). Further details: Immunocytochemistry,Immunofluorescence,Immunohistochemistry

Moreno-Fortuny, Bragg, Cossu, Roostalu: "MCAM contributes to the establishment of cell autonomous polarity in myogenic and chondrogenic differentiation." in: Biology open, Vol. 6, Issue 11, pp. 1592-1601, 1970 Method employed by authors: Immunofluorescence (fixed cells) (IF/ICC)

Images

Product Details anti-PARD3 Antibody Target Details PARD3 Application Details Handling References for anti-PARD3 antibody (ABIN4343686) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - 8505C cell...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human c...
Simple Western (SimWes) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Simple Western lane view shows a s...
Immunofluorescence (IF) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining o...
Simple Western (SimWes) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Electropherogram image(s) of corre...
Western Blotting (WB) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Western Blot: PARD3/Par3 Antibody [NBP1-88861] - Lane 1: Marker [kDa] 230, 130, 95, 7...
Immunofluorescence (IF) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Analysis o...
Immunofluorescence (IF) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunocytochemistry/Immunofluorescence: PARD3/Par3 Antibody - Staining of human cell...
Western Blotting (WB) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Western Blot: PARD3/Par3 Antibody - Analysis in human cell lines A-549 and U-251MG. ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunohistochemistry-Paraffin: PARD3/Par3 Antibody - Staining of human kidney shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunohistochemistry-Paraffin: PARD3/Par3 Antibody - Staining of human cerebellum sh...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunohistochemistry-Paraffin: PARD3/Par3 Antibody - Staining of human fallopian tub...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Par-3 Partitioning Defective 3 Homolog (C. Elegans) (PARD3) antibody (ABIN4343686) Immunohistochemistry-Paraffin: PARD3/Par3 Antibody - Staining of human skin shows we...