anti-Mouse (Murine) TMX3 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended TMX3 Antibody (supplied by: Log in to see )

Antigen
Thioredoxin-Related Transmembrane Protein 3 (TMX3) Antibodies
  • tmx3
  • pdia13
  • txndc10
  • txndc10a
  • TXNDC10
  • zgc:110025
  • txndc10b
  • DKFZp469P2316
  • PDIA13
  • 6430411B10Rik
  • A730024F05Rik
  • AV259382
  • Txndc10
  • mKIAA1830
  • thioredoxin-related transmembrane protein 3 S homeolog
  • thioredoxin related transmembrane protein 3
  • thioredoxin related transmembrane protein 3a
  • thioredoxin-related transmembrane protein 3 L homeolog
  • thioredoxin-related transmembrane protein 3
  • tmx3.S
  • TMX3
  • tmx3a
  • tmx3.L
  • tmx3
  • Tmx3
Reactivity
Human, Mouse (Murine), Rat (Rattus)
35
2
Host
Rabbit
35
Clonality
Polyclonal
Conjugate
This TMX3 antibody is un-conjugated
5
5
5
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
31
28
4
3
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4363594
Contact our Customer Service for availability and price in your country.

General

Antigen Thioredoxin-Related Transmembrane Protein 3 (TMX3) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(35), (2)
Host Rabbit
(35)
Clonality
Polyclonal
Conjugate This TMX3 antibody is un-conjugated
(5), (5), (5), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(31), (28), (4), (3)
Supplier Log in to see

Product Details anti-TMX3 Antibody

Target Details TMX3 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMF
Isotype IgG
Plasmids, Primers & others

Target Details TMX3

Product Details anti-TMX3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name TXNDC10 (TMX3 Antibody Abstract)
Background Gene Symbol: TMX3
Gene ID 54495
Pathways Cell RedoxHomeostasis

Application Details

Product Details anti-TMX3 Antibody Target Details TMX3 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TMX3 Antibody Target Details TMX3 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-TMX3 Antibody Target Details TMX3 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Thioredoxin-Related Transmembrane Protein 3 (TMX3) antibody (ABIN4363594) Immunohistochemistry-Paraffin: TXNDC10 Antibody - Staining of human stomach shows st...
Western Blotting (WB) image for anti-Thioredoxin-Related Transmembrane Protein 3 (TMX3) antibody (ABIN4363594) Western Blot: TXNDC10 Antibody - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibrob...
Western Blotting (WB) image for anti-Thioredoxin-Related Transmembrane Protein 3 (TMX3) antibody (ABIN4363594) Western Blot: TXNDC10 Antibody - Analysis in human cell lines U-251MG and MCF-7 usin...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Thioredoxin-Related Transmembrane Protein 3 (TMX3) antibody (ABIN4363594) Immunohistochemistry-Paraffin: TXNDC10 Antibody - Staining of human stomach shows st...
Western Blotting (WB) image for anti-Thioredoxin-Related Transmembrane Protein 3 (TMX3) antibody (ABIN4363594) Western Blot: TXNDC10 Antibody - Analysis in mouse cell line NIH-3T3 and rat cell li...
Western Blotting (WB) image for anti-Thioredoxin-Related Transmembrane Protein 3 (TMX3) antibody (ABIN4363594) Western Blot: TXNDC10 Antibody - Analysis in human cell line U-138MG.