anti-Human RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) Antibody (supplied by: Log in to see )

Antigen
RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) Antibodies
  • RRN3
  • DKFZp459B073
  • CG16938
  • CG3278
  • CG5951
  • Dmel\\CG3278
  • TIF-1A
  • TIF-IA
  • Tif-1A
  • TifIA
  • dTIF-IA
  • dyak_GLEANR_13182
  • DyakGE12956
  • GE12956
  • Tif-IA
  • A-270G1.2
  • TIFIA
  • RGD1305001
  • AL023001
  • E130302O19Rik
  • R75565
  • Tif1a
  • RRN3 homolog, RNA polymerase I transcription factor
  • RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
  • CG3278 gene product from transcript CG3278-RA
  • GE12956 gene product from transcript GE12956-RA
  • RRN3 homolog, RNA polymerase I transcription factor L homeolog
  • RRN3 RNA polymerase I transcription factor homolog (yeast)
  • RRN3
  • rrn3
  • Tif-IA
  • Dyak\Tif-IA
  • rrn3.L
  • Rrn3
Reactivity
Human
56
11
9
4
4
4
3
3
1
1
Host
Rabbit
51
5
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
56
35
11
3
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4351239
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2884420 ELISA IHC IHC (p) WB Rabbit IgG pSer649 Log in to see Polyclonal 0

General

Antigen RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) Antibodies
Reactivity Human
(56), (11), (9), (4), (4), (4), (3), (3), (1), (1)
Host Rabbit
(51), (5)
Clonality
Polyclonal
Conjugate Un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(56), (35), (11), (3), (2), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name RRN3 (RRN3 Antibody Abstract)
Background Gene Symbol: RRN3
Gene ID 54700
Pathways Negative Regulation of intrinsic apoptotic Signaling

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) antibody (ABIN4351239) Immunohistochemistry-Paraffin: RRN3 Antibody [NBP2-13267] - Staining of human cerebel...
Immunofluorescence (IF) image for anti-RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) antibody (ABIN4351239) Immunocytochemistry/Immunofluorescence: RRN3 Antibody [NBP2-13267] Staining of human ...
Immunofluorescence (IF) image for anti-RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) antibody (ABIN4351239) Immunocytochemistry/Immunofluorescence: RRN3 Antibody - Immunofluorescent staining o...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) antibody (ABIN4351239) Immunocytochemistry/Immunofluorescence: RRN3 Antibody - Immunofluorescent staining o...
Western Blotting (WB) image for anti-RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) antibody (ABIN4351239) Western Blot: RRN3 Antibody - Analysis in U2OS cells transfected with control siRNA,...
Western Blotting (WB) image for anti-RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) antibody (ABIN4351239) Western Blot: RRN3 Antibody - Analysis in U2OS cells transfected with control siRNA,...