anti-Human TTC5 antibody for Western Blotting

Recommended TTC5 Antibody (supplied by: Log in to see )

Antigen
Tetratricopeptide Repeat Domain 5 (TTC5) Antibodies
  • TTC5
  • ttc5
  • wu:fi33h05
  • wu:fy81e07
  • zgc:112059
  • Strap
  • 5930437N14
  • AW743060
  • tetratricopeptide repeat domain 5 L homeolog
  • tetratricopeptide repeat domain 5
  • ttc5.L
  • TTC5
  • ttc5
  • Ttc5
Epitope
C-Term
18
4
3
1
1
Reactivity
Human
32
10
2
2
2
2
2
1
1
1
1
Host
Rabbit
31
1
Clonality
Polyclonal
Conjugate
This TTC5 antibody is un-conjugated
2
2
2
1
1
1
Application
Western Blotting (WB)
26
9
5
4
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN630694
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.754771 ABIN6149672 WB Rabbit Log in to see Polyclonal 0
7.802582 ABIN1030785 IHC ELISA WB Rabbit C-Term Log in to see Polyclonal 0
4.802582 ABIN2783601 WB Rabbit C-Term Log in to see Polyclonal 1
4.802582 ABIN2463249 ELISA WB Rabbit Log in to see Polyclonal 0
4.802582 ABIN1881956 WB Rabbit AA 372-401, C-Term Log in to see Polyclonal 0
4.802582 ABIN2565968 WB Mouse AA 1-440, full length Log in to see Polyclonal 0
4.802582 ABIN3004531 WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN321559 WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN5555402 EIA IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN198088 WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN200048 IHC WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN2796149 WB Rabbit Ig Fraction AA 372-401, C-Term Log in to see Polyclonal 0
1 ABIN1839306 WB Rabbit AA 372-401 Log in to see Polyclonal 0
1 ABIN2373587 WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN6091191 ELISA WB Rabbit IgG AA 201-440 Log in to see Polyclonal 0
1 ABIN2373589 WB Alkaline Phosphatase (AP) Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN2373590 WB APC Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN2373592 WB FITC Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN2373612 WB PE Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN2373593 WB HRP Rabbit IgG C-Term Log in to see Polyclonal 0

General

Antigen Tetratricopeptide Repeat Domain 5 (TTC5) Antibodies
Epitope C-Term
(18), (4), (3), (1), (1)
Reactivity Human
(32), (10), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Host Rabbit
(31), (1)
Clonality
Polyclonal
Conjugate This TTC5 antibody is un-conjugated
(2), (2), (2), (1), (1), (1)
Application Western Blotting (WB)
(26), (9), (5), (4), (2), (2), (1)
Supplier Log in to see

Product Details anti-TTC5 Antibody

Target Details TTC5 Application Details Handling Images
Specificity TTC5 antibody was raised against the C terminal of TTC5
Purification Affinity purified
Immunogen TTC5 antibody was raised using the C terminal of TTC5 corresponding to a region with amino acids GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV
Plasmids, Primers & others

Target Details TTC5

Product Details anti-TTC5 Antibody Application Details Handling Images back to top
Antigen
Alternative Name TTC5 (TTC5 Antibody Abstract)
Background TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.
Molecular Weight 49 kDa (MW of target protein)
Pathways Chromatin Binding

Application Details

Product Details anti-TTC5 Antibody Target Details TTC5 Handling Images back to top
Application Notes WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TTC5 Blocking Peptide, catalog no. 33R-3213, is also available for use as a blocking control in assays to test for specificity of this TTC5 antibody

Restrictions For Research Use only

Handling

Product Details anti-TTC5 Antibody Target Details TTC5 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC5 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-TTC5 Antibody Target Details TTC5 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Tetratricopeptide Repeat Domain 5 (TTC5) (C-Term) antibody (ABIN630694) TTC5 antibody used at 0.25 ug/ml to detect target protein.