anti-Human C1QB antibody for Immunohistochemistry

Recommended C1QB Antibody (supplied by: Log in to see )

Antigen
Complement Component 1, Q Subcomponent, B Chain (C1QB) Antibodies
  • complement C1q B chain
  • complement component 1, q subcomponent, beta polypeptide
  • C1QB
  • C1qb
Epitope
C-Term
11
10
7
4
2
2
2
2
1
1
1
1
1
Reactivity
Human
60
10
9
3
2
2
2
2
2
1
Host
Rabbit
58
2
Clonality
Polyclonal
Conjugate
This C1QB antibody is un-conjugated
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Western Blotting (WB)
58
28
14
9
9
5
2
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN634558
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
21.987053 ABIN2773842 IHC WB Rabbit C-Term Log in to see Polyclonal 7
12.987052 ABIN6260363 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
7 ABIN320873 IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
4 ABIN1876527 IHC WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN2462806 IHC ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN2881019 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2694683 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5915520 ELISA IF/ICC IHC WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN6093994 ELISA IHC Rabbit IgG AA 104-253 Log in to see Polyclonal 0
1 ABIN6100981 ELISA IF/ICC IHC WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN6030046 IF/ICC IHC IP WB Rabbit Log in to see Polyclonal 0
1 ABIN5915517 ELISA IHC WB Rabbit Log in to see Polyclonal 0
-6.5396347 ABIN4892067 IHC IHC (p) WB Rabbit C-Term, Isoform B Log in to see Polyclonal 0
-6.5525827 ABIN4286273 IHC Rabbit IgG Log in to see Polyclonal 0

General

Antigen Complement Component 1, Q Subcomponent, B Chain (C1QB) Antibodies
Epitope C-Term
(11), (10), (7), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human
(60), (10), (9), (3), (2), (2), (2), (2), (2), (1)
Host Rabbit
(58), (2)
Clonality
Polyclonal
Conjugate This C1QB antibody is un-conjugated
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(58), (28), (14), (9), (9), (5), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-C1QB Antibody

Target Details C1QB Application Details Handling Images
Specificity C1 QB antibody was raised against the C terminal of C1 B
Purification Affinity purified
Immunogen C1 QB antibody was raised using the C terminal of C1 B corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Plasmids, Primers & others

Target Details C1QB

Product Details anti-C1QB Antibody Application Details Handling Images back to top
Antigen
Alternative Name C1QB (C1QB Antibody Abstract)
Background C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.
Molecular Weight 27 kDa (MW of target protein)
Pathways Complement System

Application Details

Product Details anti-C1QB Antibody Target Details C1QB Handling Images back to top
Application Notes WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

C1QB Blocking Peptide, catalog no. 33R-1631, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody

Restrictions For Research Use only

Handling

Product Details anti-C1QB Antibody Target Details C1QB Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 B antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-C1QB Antibody Target Details C1QB Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Complement Component 1, Q Subcomponent, B Chain (C1QB) (C-Term) antibody (ABIN634558) C1QB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Immunohistochemistry (IHC) image for anti-Complement Component 1, Q Subcomponent, B Chain (C1QB) (C-Term) antibody (ABIN634558) C1QB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magn...
Western Blotting (WB) image for anti-Complement Component 1, Q Subcomponent, B Chain (C1QB) (C-Term) antibody (ABIN634558) C1QB antibody used at 0.5 ug/ml to detect target protein.