anti-Human Kallikrein 10 antibody for Western Blotting

Recommended Kallikrein 10 Antibody

Antigen
Kallikrein 10 (KLK10) Antibodies
  • KLK10
  • 2300002A13Rik
  • NES1
  • PRSSL1
  • kallikrein related peptidase 10
  • kallikrein related-peptidase 10
  • kallikrein-related peptidase 10
  • KLK10
  • Klk10
Epitope
N-Term
12
10
9
7
7
7
6
4
4
4
3
2
2
1
1
Reactivity
Human
111
21
20
1
1
1
1
Host
Rabbit
101
12
1
Clonality
Polyclonal
Conjugate
This Kallikrein 10 antibody is un-conjugated
11
8
7
4
4
3
2
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
81
46
29
14
13
8
8
4
4
3
2
2
2
Options

Available images

Catalog No. ABIN634235
$ 449.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
16.890388 ABIN1173435 ICC IHC WB Rabbit IgG AA 35-276 Polyclonal 0
16.890388 ABIN2563584 IF IHC WB Rabbit IgG Polyclonal 0
16.890388 ABIN2936132 IF/ICC IHC IP WB Rabbit AA 35-276 Polyclonal 0
13.890388 ABIN562462 IF ELISA WB Mouse IgG Mix lambda AA 167-276 1G8 0
13.890388 ABIN562461 ELISA WB Mouse AA 167-276 Polyclonal 0
13.549533 ABIN6142943 IF IHC WB Rabbit Polyclonal 0
13.549533 ABIN6142942 IF IHC WB Rabbit Polyclonal 0
10.890388 ABIN6004312 IF/ICC IHC WB Rabbit IgG full length Polyclonal 0
10.890388 ABIN2966766 IC IF IHC WB Rabbit Polyclonal 0
10 ABIN6290548 IF IHC WB Rabbit IgG Polyclonal 0
8.5 ABIN741630 IF (p) IHC (p) WB Rabbit IgG Polyclonal 2
7.8903875 ABIN2969141 IF/ICC IHC WB Rabbit IgG Polyclonal 0
7.8903875 ABIN519342 ELISA WB Mouse IgG Mix lambda AA 167-276 1G8 0
7.8903875 ABIN6570410 IHC WB Rabbit IgG Polyclonal 0
7.8903875 ABIN2998072 WB Rabbit IgG Polyclonal 0
7.8903875 ABIN3031526 WB Rabbit IgG C-Term Polyclonal 0
7 ABIN5531500 WB Rabbit Ig Fraction AA 22-51, N-Term Polyclonal 0
7 ABIN519343 ELISA WB Mouse IgG Mix lambda AA 167-276 1B9 0
4.8903875 ABIN2786710 WB Rabbit N-Term Polyclonal 1
4.8903875 ABIN3043037 WB Rabbit IgG AA 252-265, C-Term Polyclonal 0

General

Antigen Kallikrein 10 (KLK10) Antibodies
Epitope N-Term
(12), (10), (9), (7), (7), (7), (6), (4), (4), (4), (3), (2), (2), (1), (1)
Reactivity Human
(111), (21), (20), (1), (1), (1), (1)
Host Rabbit
(101), (12), (1)
Clonality
Polyclonal
Conjugate This Kallikrein 10 antibody is un-conjugated
(11), (8), (7), (4), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(81), (46), (29), (14), (13), (8), (8), (4), (4), (3), (2), (2), (2)
Supplier

Product Details anti-Kallikrein 10 Antibody

Target Details Kallikrein 10 Application Details Handling Images
Specificity KLK10 antibody was raised against the N terminal of KLK10
Purification Affinity purified
Immunogen KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA
Plasmids, Primers & others

Target Details Kallikrein 10

Product Details anti-Kallikrein 10 Antibody Application Details Handling Images back to top
Antigen
Alternative Name KLK10 (KLK10 Antibody Abstract)
Background Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
Molecular Weight 30 kDa (MW of target protein)
Pathways Complement System

Application Details

Product Details anti-Kallikrein 10 Antibody Target Details Kallikrein 10 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody

Restrictions For Research Use only

Handling

Product Details anti-Kallikrein 10 Antibody Target Details Kallikrein 10 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-Kallikrein 10 Antibody Target Details Kallikrein 10 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Kallikrein 10 (KLK10) (N-Term) antibody (ABIN634235) KLK10 antibody used at 1 ug/ml to detect target protein.