anti-Human SLC25A32 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended SLC25A32 Antibody (supplied by: Log in to see )

Antigen
Solute Carrier Family 25, Member 32 (SLC25A32) Antibodies
  • fi40c12
  • mftc
  • wu:fi40c12
  • zgc:55610
  • zgc:110786
  • RGD1565789
  • MFT
  • MFTC
  • 2610043O12Rik
  • Mftc
  • solute carrier family 25 (mitochondrial folate carrier), member 32a
  • solute carrier family 25 (mitochondrial folate carrier), member 32b
  • NAD transporter
  • mitochondrial folate transporter/carrier
  • solute carrier family 25 member 32
  • solute carrier family 25 (mitochondrial folate carrier), member 32 L homeolog
  • solute carrier family 25, member 32
  • slc25a32a
  • slc25a32b
  • SJAG_04328
  • PAAG_07673
  • PAAG_03661
  • MCYG_01228
  • MGYG_01778
  • SLC25A32
  • Slc25a32
  • slc25a32.L
Reactivity
Human
13
8
7
6
4
4
4
3
3
2
2
2
2
2
1
1
Host
Rabbit
13
Clonality
Polyclonal
Conjugate
This SLC25A32 antibody is un-conjugated
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
10
5
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4354166
Contact our Customer Service for availability and price in your country.

General

Antigen Solute Carrier Family 25, Member 32 (SLC25A32) Antibodies
Reactivity Human
(13), (8), (7), (6), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(13)
Clonality
Polyclonal
Conjugate This SLC25A32 antibody is un-conjugated
(1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(10), (5)
Supplier Log in to see

Product Details anti-SLC25A32 Antibody

Target Details SLC25A32 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRF AVSDGLELRPKYNGILHCLTTIWKLDGLR
Isotype IgG
Plasmids, Primers & others

Target Details SLC25A32

Product Details anti-SLC25A32 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SLC25A32 (SLC25A32 Antibody Abstract)
Background Gene Symbol: SLC25A32
Gene ID 81034
Pathways Dicarboxylic Acid Transport

Application Details

Product Details anti-SLC25A32 Antibody Target Details SLC25A32 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SLC25A32 Antibody Target Details SLC25A32 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-SLC25A32 Antibody Target Details SLC25A32 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 25, Member 32 (SLC25A32) antibody (ABIN4354166) Immunohistochemistry-Paraffin: SLC25A32 Antibody [NBP2-13322] Staining of human stoma...