anti-Rat (Rattus) SLC25A32 antibody for Western Blotting

Recommended SLC25A32 Antibody (supplied by: Log in to see )

Antigen
Solute Carrier Family 25, Member 32 (SLC25A32) Antibodies
  • fi40c12
  • mftc
  • wu:fi40c12
  • zgc:55610
  • zgc:110786
  • RGD1565789
  • MFT
  • MFTC
  • 2610043O12Rik
  • Mftc
  • solute carrier family 25 (mitochondrial folate carrier), member 32a
  • solute carrier family 25 (mitochondrial folate carrier), member 32b
  • NAD transporter
  • mitochondrial folate transporter/carrier
  • solute carrier family 25 member 32
  • solute carrier family 25 (mitochondrial folate carrier), member 32 L homeolog
  • solute carrier family 25, member 32
  • slc25a32a
  • slc25a32b
  • SJAG_04328
  • PAAG_07673
  • PAAG_03661
  • MCYG_01228
  • MGYG_01778
  • SLC25A32
  • Slc25a32
  • slc25a32.L
Epitope
Middle Region
4
2
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
12
7
6
6
4
4
4
3
3
2
2
2
2
2
1
1
Host
Rabbit
12
Clonality
Polyclonal
Conjugate
This SLC25A32 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
8
5
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN635047
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
15.753838 ABIN635067 WB Rabbit N-Term Log in to see Polyclonal 0
15.227556 ABIN2781692 WB Rabbit N-Term Log in to see Polyclonal 1
4.727556 ABIN2781693 WB Rabbit Middle Region Log in to see Polyclonal 1
4.727556 ABIN2462769 ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN225214 WB Rabbit IgG AA 21-70 Log in to see Polyclonal 0
4 ABIN468943 WB Rabbit AA 215-264 Log in to see Polyclonal 0

General

Antigen Solute Carrier Family 25, Member 32 (SLC25A32) Antibodies
Epitope Middle Region
(4), (2), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(12), (7), (6), (6), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(12)
Clonality
Polyclonal
Conjugate This SLC25A32 antibody is un-conjugated
(1), (1), (1)
Application Western Blotting (WB)
(8), (5), (1), (1)
Supplier Log in to see

Product Details anti-SLC25A32 Antibody

Target Details SLC25A32 Application Details Handling Images
Specificity SLC25 A32 antibody was raised against the middle region of SLC25 32
Purification Affinity purified
Immunogen SLC25 A32 antibody was raised using the middle region of SLC25 32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID
Plasmids, Primers & others

Target Details SLC25A32

Product Details anti-SLC25A32 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SLC25A32 (SLC25A32 Antibody Abstract)
Background SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria.
Molecular Weight 35 kDa (MW of target protein)
Pathways Dicarboxylic Acid Transport

Application Details

Product Details anti-SLC25A32 Antibody Target Details SLC25A32 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SLC25A32 Blocking Peptide, catalog no. 33R-6857, is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Restrictions For Research Use only

Handling

Product Details anti-SLC25A32 Antibody Target Details SLC25A32 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-SLC25A32 Antibody Target Details SLC25A32 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Solute Carrier Family 25, Member 32 (SLC25A32) (Middle Region) antibody (ABIN635047) SLC25A32 antibody used at 1 ug/ml to detect target protein.