anti-Human Family with Sequence Similarity 175, Member A antibody for Immunofluorescence

Recommended Family with Sequence Similarity 175, Member A Antibody (supplied by: Log in to see )

Antigen
Family with Sequence Similarity 175, Member A (FAM175A) Antibodies
  • CCDC98
  • abra1
  • ccdc98
  • fam175a
  • ABRA1
  • 3830405G04Rik
  • 5630400M01Rik
  • AI506069
  • AL024423
  • AV118690
  • Ccdc98
  • RGD1305287
  • zgc:103522
  • abraxas 1, BRCA1 A complex subunit
  • Coiled-coil domain-containing protein 98
  • BRCA1 A complex subunit
  • family with sequence similarity 175 member A
  • abraxas 2a, BRISC complex subunit
  • abraxas 1, BRCA1 A complex subunit S homeolog
  • ABRAXAS1
  • abraxas1
  • Abraxas1
  • FAM175A
  • abraxas2a
  • abraxas1.S
Reactivity
Human
55
26
20
4
2
2
1
1
1
1
Host
Rabbit
46
10
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
41
21
18
16
15
13
9
3
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN4277467
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1894726 IF IHC IHC (p) IP Rabbit IgG AA 400-409 Log in to see Polyclonal 0
1 ABIN1894727 IF IHC IHC (p) Rabbit IgG AA 400-409 Log in to see Polyclonal 0
1 ABIN2220784 IF IHC ELISA WB Rabbit IgG N-Term Log in to see Polyclonal 0

General

Antigen Family with Sequence Similarity 175, Member A (FAM175A) Antibodies
Reactivity Human
(55), (26), (20), (4), (2), (2), (1), (1), (1), (1)
Host Rabbit
(46), (10)
Clonality
Polyclonal
Conjugate Un-conjugated
(3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(41), (21), (18), (16), (15), (13), (9), (3), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: CNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKTLDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPT

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name Abraxas (FAM175A Antibody Abstract)
Background Gene Symbol: FAM175A
Gene ID 84142
UniProt Q6UWZ7
Pathways DNA Damage Repair, Positive Regulation of Response to DNA Damage Stimulus

Application Details

Product details Target Details Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Family with Sequence Similarity 175, Member A (FAM175A) antibody (ABIN4277467) Immunohistochemistry: Abraxas Antibody [NBP2-38356] - Staining of human testis shows ...
Immunofluorescence (IF) image for anti-Family with Sequence Similarity 175, Member A (FAM175A) antibody (ABIN4277467) Immunocytochemistry/Immunofluorescence: Abraxas Antibody [NBP2-38356] - Immunofluores...
Western Blotting (WB) image for anti-Family with Sequence Similarity 175, Member A (FAM175A) antibody (ABIN4277467) Western Blot: Abraxas Antibody [NBP2-38356] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...