anti-Human ADCY4 antibody for Immunohistochemistry

Recommended ADCY4 Antibody (supplied by: Log in to see )

Antigen
Adenylate Cyclase 4 (ADCY4) Antibodies
  • ADCY4
  • mKIAA4004
  • AC4
  • adenylate cyclase 4
  • ADCY4
  • Adcy4
Reactivity
Human
64
39
38
Host
Rabbit
67
Clonality
Polyclonal
Conjugate
This ADCY4 antibody is un-conjugated
4
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
49
34
17
13
11
5
4
3
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4278340
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.883907 ABIN2422467 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
8.883907 ABIN2429053 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN6095761 ELISA IHC Rabbit IgG AA 808-1077 Log in to see Polyclonal 0
1 ABIN6095763 ELISA IHC Rabbit IgG AA 808-1077 Log in to see Polyclonal 0
1 ABIN6043981 ELISA IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN6044275 ELISA IHC Rabbit IgG Log in to see Polyclonal 0
1 ABIN2749264 CM ICC IF IHC ELISA WB FITC Rabbit IgG Log in to see Polyclonal 0
1 ABIN2746160 CM ICC IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5557618 CM ELISA ICC IF IHC WB Biotin Rabbit Log in to see Polyclonal 0

General

Antigen Adenylate Cyclase 4 (ADCY4) Antibodies
Reactivity Human
(64), (39), (38)
Host Rabbit
(67)
Clonality
Polyclonal
Conjugate This ADCY4 antibody is un-conjugated
(4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(49), (34), (17), (13), (11), (5), (4), (3), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-ADCY4 Antibody

Target Details ADCY4 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIP
Plasmids, Primers & others

Target Details ADCY4

Product Details anti-ADCY4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ADCY4 (ADCY4 Antibody Abstract)
Background Gene Symbol: ADCY4
Gene ID 196883
UniProt Q8NFM4
Pathways EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma

Application Details

Product Details anti-ADCY4 Antibody Target Details ADCY4 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-ADCY4 Antibody Target Details ADCY4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-ADCY4 Antibody Target Details ADCY4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Adenylate Cyclase 4 (ADCY4) antibody (ABIN4278340) Immunohistochemistry: ADCY4 Antibody [NBP2-37920] - Staining of human stomach, lower ...