anti-Human Adenylate Cyclase 7 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Adenylate Cyclase 7 Antibody (supplied by: Log in to see )

Antigen
Adenylate Cyclase 7 (Adcy7) Antibodies
  • ADCY7
  • ADCY4a
  • AC7
  • AA407758
  • ac7
  • adenylate cyclase 7
  • adenylate cyclase 7 L homeolog
  • ADCY7
  • adcy7
  • Adcy7
  • adcy7.L
Reactivity
Human
34
26
19
Host
Rabbit
35
1
Clonality
Polyclonal
Conjugate
Un-conjugated
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
16
14
13
12
7
6
5
3
3
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4278419
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN751213 IF (p) IHC (p) WB Rabbit IgG AA 905-955 Log in to see Polyclonal 0
1 ABIN751222 IHC (p) WB HRP Rabbit IgG AA 905-955 Log in to see Polyclonal 0
1 ABIN5572037 ELISA IF IHC IHC (p) Rabbit Log in to see Polyclonal 0
1 ABIN751215 IHC (p) WB Biotin Rabbit IgG AA 905-955 Log in to see Polyclonal 0
1 ABIN1805693 FACS IHC IHC (p) WB Rabbit AA 510-539 Log in to see Polyclonal 0
1 ABIN2883442 ELISA IF IHC IHC (p) Rabbit IgG AA 191-240 Log in to see Polyclonal 0

General

Antigen Adenylate Cyclase 7 (Adcy7) Antibodies
Reactivity Human
(34), (26), (19)
Host Rabbit
(35), (1)
Clonality
Polyclonal
Conjugate Un-conjugated
(2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(16), (14), (13), (12), (7), (6), (5), (3), (3), (2), (2)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSY DDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFL
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Antigen
Alternative Name Adenylate Cyclase 7 (Adcy7 Antibody Abstract)
Background Gene Symbol: ADCY7
Gene ID 113
UniProt P51828
Pathways EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma

Application Details

Product details Target Details Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin, HIER pH 6 antigen retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product details Target Details Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Adenylate Cyclase 7 (Adcy7) antibody (ABIN4278419) Immunohistochemistry-Paraffin: Adenylate Cyclase 7 Antibody [NBP2-14268] Staining of ...