anti-Mouse (Murine) SOX9 antibody for Immunocytochemistry

Recommended SOX9 Antibody (supplied by: Log in to see )

Antigen
SRY (Sex Determining Region Y)-Box 9 (SOX9) Antibodies
  • LOC100227849
  • SOX9
  • CMD1
  • CMPD1
  • SRA1
  • SOX-9
  • 2010306G03Rik
  • AV220920
  • mKIAA4243
  • SRY-box 9
  • transcription factor SOX-9
  • SRY-box 10
  • SRY (sex determining region Y)-box 9
  • SRY box 9
  • SOX9
  • LOC100227849
  • SOX10
  • Sox9
Reactivity
Human, Mouse (Murine), Rat (Rattus)
196
66
41
15
9
8
4
4
4
4
3
2
2
2
2
2
1
1
Host
Rabbit
140
54
5
Clonality
Polyclonal
Conjugate
This SOX9 antibody is un-conjugated
6
6
6
5
4
4
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
167
91
69
67
44
24
15
14
12
9
7
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4355424
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN5950738 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG AA 150-300 Log in to see SN74-09 0
1 ABIN6265242 ELISA ICC IF IHC IP WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6255043 ELISA ICC IF IHC WB Rabbit IgG pSer181 Log in to see Polyclonal 0
1 ABIN2858102 ICC IF IHC WB Rabbit pSer181 Log in to see Polyclonal 0
1 ABIN2858952 ICC IF IHC WB Rabbit Log in to see Polyclonal 0

General

Antigen SRY (Sex Determining Region Y)-Box 9 (SOX9) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(196), (66), (41), (15), (9), (8), (4), (4), (4), (4), (3), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(140), (54), (5)
Clonality
Polyclonal
Conjugate This SOX9 antibody is un-conjugated
(6), (6), (6), (5), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(167), (91), (69), (67), (44), (24), (15), (14), (12), (9), (7), (3), (2), (1), (1)
Pubmed 10 references available
Supplier Log in to see

Product Details anti-SOX9 Antibody

Target Details SOX9 Application Details Handling References for anti-SOX9 antibody (ABIN4355424) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Isotype IgG
Plasmids, Primers & others

Target Details SOX9

Product Details anti-SOX9 Antibody Application Details Handling References for anti-SOX9 antibody (ABIN4355424) Images back to top
Antigen
Alternative Name SOX9 (SOX9 Antibody Abstract)
Background Gene Symbol: SOX9
Gene ID 6662
UniProt P48436
Pathways EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development

Application Details

Product Details anti-SOX9 Antibody Target Details SOX9 Handling References for anti-SOX9 antibody (ABIN4355424) Images back to top
Application Notes Western Blot 1:100-1:500, Simple Western 1:100, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SOX9 Antibody Target Details SOX9 Application Details References for anti-SOX9 antibody (ABIN4355424) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-SOX9 antibody (ABIN4355424)

Product Details anti-SOX9 Antibody Target Details SOX9 Application Details Handling Images back to top
Product cited in:

Leijten, Teixeira, Bolander, Ji, Vanspauwen, Lammertyn, Schrooten, Luyten: "Bioinspired seeding of biomaterials using three dimensional microtissues induces chondrogenic stem cell differentiation and cartilage formation under growth factor free conditions." in: Scientific reports, Vol. 6, pp. 36011, 2016 (Sample species: Human).

Roy, Malik, Villanueva, Urano, Lu, Von Figura, Seeley, Dawson, Collisson, Hebrok: "Brg1 promotes both tumor-suppressive and oncogenic activities at distinct stages of pancreatic cancer formation." in: Genes & development, Vol. 29, Issue 6, pp. 658-71, 2015 (Sample species: Mouse (Murine)). Further details: Immunocytochemistry,Immunofluorescence,Immunohistochemistry

Fantinato, Milani, Sironi: "Sox9 expression in canine epithelial skin tumors." in: European journal of histochemistry : EJH, Vol. 59, Issue 3, pp. 2514, 2015 (Sample species: Dog (Canine)). Further details: Immunohistochemistry

Brenig, Duan, Xing, Ding, Huang, Schütz: "Porcine SOX9 Gene Expression Is Influenced by an 18 bp Indel in the 5'-Untranslated Region." in: PLoS ONE, Vol. 10, Issue 10, pp. e0139583, 2015 (Sample species: Pig (Porcine)). Further details: Electrophoretic Mobility-Shift Assay

Chen, Chen, Chien, Wu, Ho, Yu, Chang: "Contribution of Mature Hepatocytes to Biliary Regeneration in Rats with Acute and Chronic Biliary Injury." in: PLoS ONE, Vol. 10, Issue 8, pp. e0134327, 2015 (Sample species: Rat (Rattus)). Further details: Immunohistochemistry

Poulsen, Knowles, Carr, Hulley: "Cell differentiation versus cell death: extracellular glucose is a key determinant of cell fate following oxidative stress exposure." in: Cell death & disease, Vol. 5, pp. e1074, 2014

Bruun, Kolberg, Nesland, Svindland, Nesbakken, Lothe: "Prognostic Significance of β-Catenin, E-Cadherin, and SOX9 in Colorectal Cancer: Results from a Large Population-Representative Series." in: Frontiers in oncology, Vol. 4, pp. 118, 2014

Capaccione, Hong, Morgan, Liu, Bishop, Liu, Markert, Deen, Minerowicz, Bertino, Allen, Pine: "Sox9 mediates Notch1-induced mesenchymal features in lung adenocarcinoma." in: Oncotarget, Vol. 5, Issue 11, pp. 3636-50, 2014 (Sample species: Human). Further details: Western Blotting,Immunohistochemistry

Rizzardi, Rosener, Koopmeiners, Isaksson Vogel, Metzger, Forster, Marston, Tiffany, McCarthy, Turley, Warlick, Henriksen, Schmechel: "Evaluation of protein biomarkers of prostate cancer aggressiveness." in: BMC cancer, Vol. 14, pp. 244, 2014 (Sample species: Human). Further details: Immunohistochemistry

Vestentoft, Jelnes, Hopkinson, Vainer, Møllgård, Quistorff, Bisgaard: "Three-dimensional reconstructions of intrahepatic bile duct tubulogenesis in human liver." in: BMC developmental biology, Vol. 11, pp. 56, 2011

Images

Product Details anti-SOX9 Antibody Target Details SOX9 Application Details Handling References for anti-SOX9 antibody (ABIN4355424) back to top
Supplier Images
Immunofluorescence (IF) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunocytochemistry/Immunofluorescence: SOX9 Antibody [NBP1-85551] - Staining of huma...
Western Blotting (WB) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Western Blot: SOX9 Antibody [NBP1-85551] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human testis ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human testis ...
Western Blotting (WB) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Western Blot: SOX9 Antibody [NBP1-85551] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Simple Western (SimWes) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Simple Western: SOX9 Antibody [NBP1-85551] - Electropherogram image(s) of correspondi...
Simple Western (SimWes) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Simple Western: SOX9 Antibody [NBP1-85551] - Simple Western lane view shows a specifi...
Western Blotting (WB) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Western Blot: SOX9 Antibody - Analysis in U-251MG cells transfected with control siR...
Western Blotting (WB) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Western Blot: SOX9 Antibody - Analysis in U-251MG cells transfected with control siR...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunohistochemistry-Paraffin: SOX9 Antibody - Staining in human testis and skeletal...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunohistochemistry-Paraffin: SOX9 Antibody - Staining of human skeletal muscle sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunohistochemistry-Paraffin: SOX9 Antibody - Staining of human testis shows modera...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunohistochemistry-Paraffin: SOX9 Antibody - Staining of human small intestine sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunohistochemistry-Paraffin: SOX9 Antibody - Staining of human glioma shows modera...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunohistochemistry-Paraffin: SOX9 Antibody - Staining of human colorectal cancer s...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-SRY (Sex Determining Region Y)-Box 9 (SOX9) antibody (ABIN4355424) Immunocytochemistry/Immunofluorescence: SOX9 Antibody - Staining of human cell line ...