anti-Fruit Fly (Drosophila melanogaster) LAT2 antibody for Western Blotting

Recommended LAT2 Antibody (supplied by: Log in to see )

Antigen
Linker For Activation of T Cells Family, Member 2 (LAT2) Antibodies
  • LAB
  • NTAL
  • WBSCR15
  • WBSCR5
  • WSCR5
  • LAT2
  • MGC139435
  • Ntal
  • Wbscr5
  • AW125574
  • Wbscr15
  • linker for activation of T-cells family member 2
  • linker for activation of T cells family, member 2
  • LAT2
  • Lat2
Epitope
N-Term
16
15
11
11
11
10
8
7
6
5
5
5
5
2
2
2
2
2
2
2
1
1
1
1
1
Reactivity
Fruit Fly (Drosophila melanogaster)
118
36
24
3
3
2
1
1
1
1
1
Host
Rabbit
94
36
14
1
Clonality
Polyclonal
Conjugate
This LAT2 antibody is un-conjugated
8
6
6
3
3
3
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
134
43
32
28
21
16
12
6
5
3
3
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Catalog No. ABIN630764
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
4.8439007 ABIN2783156 WB Rabbit N-Term Log in to see Polyclonal 0
4.8439007 ABIN2463107 IHC ELISA WB Rabbit Log in to see Polyclonal 0

General

Antigen Linker For Activation of T Cells Family, Member 2 (LAT2) Antibodies
Epitope N-Term
(16), (15), (11), (11), (11), (10), (8), (7), (6), (5), (5), (5), (5), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Fruit Fly (Drosophila melanogaster)
(118), (36), (24), (3), (3), (2), (1), (1), (1), (1), (1)
Host Rabbit
(94), (36), (14), (1)
Clonality
Polyclonal
Conjugate This LAT2 antibody is un-conjugated
(8), (6), (6), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(134), (43), (32), (28), (21), (16), (12), (6), (5), (3), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-LAT2 Antibody

Target Details LAT2 Application Details Handling Images
Specificity LAB antibody was raised against the N terminal Of Lab
Purification Affinity purified
Immunogen LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
Plasmids, Primers & others

Target Details LAT2

Product Details anti-LAT2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name LAB (LAT2 Antibody Abstract)
Background Lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
Molecular Weight 54 kDa (MW of target protein)
Pathways Fc-epsilon Receptor Signaling Pathway

Application Details

Product Details anti-LAT2 Antibody Target Details LAT2 Handling Images back to top
Application Notes WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

LAB Blocking Peptide, catalog no. 33R-6229, is also available for use as a blocking control in assays to test for specificity of this LAB antibody

Restrictions For Research Use only

Handling

Product Details anti-LAT2 Antibody Target Details LAT2 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAB antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.