anti-Human Stanniocalcin 2 antibody for Immunofluorescence

Recommended Stanniocalcin 2 Antibody (supplied by: Log in to see )

Antigen
Stanniocalcin 2 (STC2) Antibodies
  • STC2
  • im:6908722
  • stc2
  • wu:fd13c01
  • zgc:136650
  • MGC145691
  • STC-2
  • STCRP
  • AW125853
  • Stc2l
  • mustc2
  • stanniocalcin 2
  • stanniocalcin 2a
  • STC2
  • stc2a
  • stc2
  • Stc2
Reactivity
Human
105
58
27
6
6
5
3
3
3
1
1
1
1
Host
Rabbit
88
26
2
2
Clonality
Polyclonal
Conjugate
This Stanniocalcin 2 antibody is un-conjugated
7
6
5
5
5
4
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
74
62
46
16
13
6
5
4
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4356204
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.666044 ABIN5566189 FACS ICC IF IHC APC Rabbit AA 25-302 Log in to see Polyclonal 0
1 ABIN1938745 IF IP IHC (p) WB Rabbit IgG AA 252-302 Log in to see Polyclonal 0
1 ABIN5566192 FACS ICC IF IHC PE Rabbit AA 25-302 Log in to see Polyclonal 0
1 ABIN5566190 FACS ICC IF IHC FITC Rabbit AA 25-302 Log in to see Polyclonal 0
1 ABIN5588883 IF IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5698489 ELISA IF IHC WB Mouse IgG2a Log in to see 0

General

Antigen Stanniocalcin 2 (STC2) Antibodies
Reactivity Human
(105), (58), (27), (6), (6), (5), (3), (3), (3), (1), (1), (1), (1)
Host Rabbit
(88), (26), (2), (2)
Clonality
Polyclonal
Conjugate This Stanniocalcin 2 antibody is un-conjugated
(7), (6), (5), (5), (5), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(74), (62), (46), (16), (13), (6), (5), (4), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Stanniocalcin 2 Antibody

Target Details Stanniocalcin 2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SAIQKPPTAPPERQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDIRR
Isotype IgG

Target Details Stanniocalcin 2

Product Details anti-Stanniocalcin 2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Stanniocalcin 2/STC-2 (STC2 Antibody Abstract)
Background Gene Symbol: STC2
Gene ID 8614
Pathways Hormone Activity, ER-Nucleus Signaling

Application Details

Product Details anti-Stanniocalcin 2 Antibody Target Details Stanniocalcin 2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Stanniocalcin 2 Antibody Target Details Stanniocalcin 2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Stanniocalcin 2 Antibody Target Details Stanniocalcin 2 Application Details Handling back to top
Supplier Images
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Stanniocalcin 2 (STC2) antibody (ABIN4356204) Immunohistochemistry-Paraffin: Stanniocalcin 2/STC-2 Antibody - Staining of human pr...
Western Blotting (WB) image for anti-Stanniocalcin 2 (STC2) antibody (ABIN4356204) Western Blot: Stanniocalcin 2/STC-2 Antibody 250, 130, 95, 72, 55, 36, 28, 17, 10. L...
Immunofluorescence (IF) image for anti-Stanniocalcin 2 (STC2) antibody (ABIN4356204) Immunocytochemistry/Immunofluorescence: Stanniocalcin 2/STC-2 Antibody - Immunofluor...