anti-Human MTM1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MTM1 Antibody (supplied by: Log in to see )

Antigen
Myotubularin 1 (MTM1) Antibodies
  • wu:fb19c01
  • zgc:123266
  • CNM
  • MTMX
  • XLMTM
  • AF073996
  • Mtm
  • mKIAA4176
  • myotubularin 1
  • X-linked myotubular myopathy gene 1
  • MTM1
  • mtm1
  • Mtm1
Reactivity
Human
77
49
25
5
3
2
2
1
1
1
1
Host
Rabbit
65
9
4
Clonality
Polyclonal
Conjugate
This MTM1 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
58
33
14
13
10
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4337571
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
14.682871 ABIN1386965 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
14.682871 ABIN4337569 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN1882103 IHC (p) WB Rabbit AA 1-30, N-Term Log in to see Polyclonal 6
1 ABIN561867 IHC (p) RNAi ELISA WB Mouse IgG2a kappa AA 1-100, partial Log in to see 1C10 1
1 ABIN598823 IHC (p) ELISA WB Mouse IgG2a, kappa AA 1-100 Log in to see 1C10
1 ABIN1419160 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1401289 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN1859899 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG AA 315-482 Log in to see
1 ABIN2893895 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN4337570 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal

General

Antigen Myotubularin 1 (MTM1) Antibodies
Reactivity Human
(77), (49), (25), (5), (3), (2), (2), (1), (1), (1), (1)
Host Rabbit
(65), (9), (4)
Clonality
Polyclonal
Conjugate This MTM1 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(58), (33), (14), (13), (10), (2), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-MTM1 Antibody

Target Details MTM1 Application Details Handling References for anti-MTM1 antibody (ABIN4337571) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANK
Isotype IgG

Target Details MTM1

Product Details anti-MTM1 Antibody Application Details Handling References for anti-MTM1 antibody (ABIN4337571) Images back to top
Antigen
Alternative Name Myotubularin (MTM1 Antibody Abstract)
Background Gene Symbol: MTM1
Gene ID 4534
Pathways Inositol Metabolic Process, Skeletal Muscle Fiber Development

Application Details

Product Details anti-MTM1 Antibody Target Details MTM1 Handling References for anti-MTM1 antibody (ABIN4337571) Images back to top
Application Notes Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MTM1 Antibody Target Details MTM1 Application Details References for anti-MTM1 antibody (ABIN4337571) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-MTM1 antibody (ABIN4337571)

Product Details anti-MTM1 Antibody Target Details MTM1 Application Details Handling Images back to top
Product cited in:

Agrawal, Pierson, Joshi, Liu, Ravenscroft, Moghadaszadeh, Talabere, Viola, Swanson, Haliloğlu, Talim, Yau, Allcock, Laing, Perrella, Beggs: "SPEG interacts with myotubularin, and its deficiency causes centronuclear myopathy with dilated cardiomyopathy." in: American journal of human genetics, Vol. 95, Issue 2, pp. 218-26, 2014 (Sample species: Human). Further details: Immunocytochemistry,Immunofluorescence

Gupta, Hnia, Smith, Gundry, McIntire, Shimazu, Bass, Talbot, Amoasii, Goldman, Laporte, Beggs: "Loss of catalytically inactive lipid phosphatase myotubularin-related protein 12 impairs myotubularin stability and promotes centronuclear myopathy in zebrafish." in: PLoS genetics, Vol. 9, Issue 6, pp. e1003583, 2013

Images

Product Details anti-MTM1 Antibody Target Details MTM1 Application Details Handling References for anti-MTM1 antibody (ABIN4337571) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Myotubularin 1 (MTM1) antibody (ABIN4337571) Immunohistochemistry-Paraffin: Myotubularin Antibody [NBP1-86113] - Staining of human...
Western Blotting (WB) image for anti-Myotubularin 1 (MTM1) antibody (ABIN4337571) Western Blot: Myotubularin Antibody [NBP1-86113] - Lane 1: Marker [kDa] 230, 130, 95,...
Immunofluorescence (IF) image for anti-Myotubularin 1 (MTM1) antibody (ABIN4337571) Immunocytochemistry/Immunofluorescence: Myotubularin Antibody [NBP1-86113] - Immunofl...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Myotubularin 1 (MTM1) antibody (ABIN4337571) Immunohistochemistry-Paraffin: Myotubularin Antibody - Staining of human kidney show...