anti-Mouse (Murine) IL15 antibody for Western Blotting

Recommended IL15 Antibody (supplied by: Log in to see )

Antigen
Interleukin 15 (IL15) Antibodies
  • IL15
  • AI503618
  • IL-15
  • interleukin 15
  • IL15
  • Il15
Epitope
N-Term
72
14
11
7
6
5
5
5
2
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
208
72
27
12
9
7
5
3
2
1
1
1
1
1
1
Host
Rabbit
165
101
18
17
6
6
Clonality
Polyclonal
Conjugate
This IL15 antibody is un-conjugated
41
18
10
9
8
5
3
3
3
3
3
2
2
2
2
2
2
2
1
1
1
1
Application
Western Blotting (WB)
234
152
70
38
26
26
22
17
13
12
11
10
5
4
3
3
3
1
1
1
1
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN634483
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
16.184578 ABIN289470 WB Rabbit Log in to see Polyclonal 0
12.434076 ABIN5622067 WB Rabbit IgG Log in to see Polyclonal 0
7.750501 ABIN6262535 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
7.750501 ABIN6257295 ELISA IHC WB Rabbit IgG Log in to see Polyclonal 0
7.750501 ABIN1078228 ICC IHC WB Rabbit IgG AA 49-162 Log in to see Polyclonal 0
7.750501 ABIN2935376 IF/ICC IHC IP WB Rabbit AA 49-162 Log in to see Polyclonal 0
7 ABIN465267 Neut ELISA WB Rabbit Log in to see Polyclonal 0
4.750501 ABIN2786287 WB Rabbit N-Term Log in to see Polyclonal 0
4.750501 ABIN1077441 ELISA WB Rabbit IgG Log in to see 0
4.750501 ABIN223547 WB Rabbit IgG Log in to see Polyclonal 0
4.750501 ABIN2682122 WB Rabbit IgG Center Log in to see Polyclonal 0
4.750501 ABIN2459939 ELISA WB Rabbit Log in to see Polyclonal 0
4.750501 ABIN550053 WB Rabbit Log in to see Polyclonal 0
4 ABIN464009 WB Rabbit IgG N-Term Log in to see Polyclonal 0
4 ABIN1904936 ELISA IHC IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal 0
4 ABIN735053 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
4 ABIN242222 WB Rabbit Log in to see Polyclonal 0
1 ABIN2609468 WB Rabbit IgG AA 49-162 Log in to see Polyclonal 0
1 ABIN2860955 IHC ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN2609476 WB Biotin Rabbit IgG AA 49-162 Log in to see Polyclonal 0

General

Antigen Interleukin 15 (IL15) Antibodies
Epitope N-Term
(72), (14), (11), (7), (6), (5), (5), (5), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(208), (72), (27), (12), (9), (7), (5), (3), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(165), (101), (18), (17), (6), (6)
Clonality
Polyclonal
Conjugate This IL15 antibody is un-conjugated
(41), (18), (10), (9), (8), (5), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Application Western Blotting (WB)
(234), (152), (70), (38), (26), (26), (22), (17), (13), (12), (11), (10), (5), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL15 Antibody

Target Details IL15 Application Details Handling Images
Specificity IL15 antibody was raised against the N terminal of IL15
Purification Affinity purified
Immunogen IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
Plasmids, Primers & others

Target Details IL15

Product Details anti-IL15 Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL15 (IL15 Antibody Abstract)
Background IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis.
Molecular Weight 13 kDa (MW of target protein)
Pathways JAK-STAT Signaling, Glycosaminoglycan Metabolic Process

Application Details

Product Details anti-IL15 Antibody Target Details IL15 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

IL15 Blocking Peptide, catalog no. 33R-7982, is also available for use as a blocking control in assays to test for specificity of this IL15 antibody

Restrictions For Research Use only

Handling

Product Details anti-IL15 Antibody Target Details IL15 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL15 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-IL15 Antibody Target Details IL15 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Interleukin 15 (IL15) (N-Term) antibody (ABIN634483) IL15 antibody used at 1 ug/ml to detect target protein.