anti-Human IL4 Receptor antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL4 Receptor Antibody (supplied by: Log in to see )

Antigen
Interleukin 4 Receptor (IL4R) Antibodies
  • IL4R
  • il-4ra
  • zgc:113063
  • CD124
  • IL-4RA
  • IL4RA
  • Il4ra
  • IL4
  • Il4r
  • interleukin 4 receptor
  • interleukin 4 receptor, tandem duplicate 1
  • interleukin 4 receptor, alpha
  • IL4R
  • il4r.1
  • Il4r
  • Il4ra
Reactivity
Human
129
64
11
Host
Rabbit
71
69
25
12
1
Clonality
Polyclonal
Conjugate
This IL4 Receptor antibody is un-conjugated
10
9
4
4
4
4
3
2
2
2
2
2
2
2
2
2
2
2
2
2
2
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
105
62
49
37
25
14
11
10
7
6
3
3
3
3
2
2
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4325317
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.982011 ABIN740565 IF (p) IHC (p) WB Rabbit IgG AA 200-232 Log in to see Polyclonal 0
12.982011 ABIN498468 IHC (p) Rabbit Log in to see Polyclonal 0
1 ABIN112606 EIA Func FACS IHC (p) WB Mouse IgG1 Extracellular Domain Log in to see 25463 (49-20) 0
1 ABIN599796 ELISA FACS Func IHC IHC (p) WB Mouse IgG1 Extracellular Domain Log in to see 0
1 ABIN260346 FACS IHC (p) IHC ELISA WB Mouse IgG1 Log in to see 49-20 0
1 ABIN2892814 IHC IHC (p) Rabbit Ser254 Log in to see Polyclonal 0
1 ABIN198262 ELISA FACS IHC IHC (p) WB Mouse IgG1 Extracellular Domain Log in to see 49-20 0
1 ABIN5956945 ELISA IF IHC (p) WB Rabbit IgG pTyr497 Log in to see Polyclonal 0
1 ABIN4225972 BP IHC IHC (p) Neut WB Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN3031482 IHC (p) WB Rabbit IgG Middle Region Log in to see Polyclonal 0
1 ABIN5598163 IHC IHC (p) WB Alexa Fluor 488 Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598166 IHC IHC (p) WB Biotin Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598162 IHC IHC (p) WB Alexa Fluor 405 Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598168 IHC IHC (p) WB DyLight 405 Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598169 IHC IHC (p) WB DyLight 488 Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598170 IHC IHC (p) WB DyLight 550 Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598165 IHC IHC (p) WB Alexa Fluor 700 Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598171 IHC IHC (p) WB DyLight 650 Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598172 IHC IHC (p) WB DyLight 680 Mouse IgG1 Log in to see MM0405-4Y44 0
1 ABIN5598173 IHC IHC (p) WB DyLight 755 Mouse IgG1 Log in to see MM0405-4Y44 0

General

Antigen Interleukin 4 Receptor (IL4R) Antibodies
Reactivity Human
(129), (64), (11)
Host Rabbit
(71), (69), (25), (12), (1)
Clonality
Polyclonal
Conjugate This IL4 Receptor antibody is un-conjugated
(10), (9), (4), (4), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(105), (62), (49), (37), (25), (14), (11), (10), (7), (6), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-IL4 Receptor Antibody

Target Details IL4 Receptor Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVS
Isotype IgG
Plasmids, Primers & others

Target Details IL4 Receptor

Product Details anti-IL4 Receptor Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL-4 R alpha (IL4R Antibody Abstract)
Background Gene Symbol: IL4R
Gene ID 3566
UniProt P24394
Pathways JAK-STAT Signaling, Positive Regulation of Immune Effector Process

Application Details

Product Details anti-IL4 Receptor Antibody Target Details IL4 Receptor Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL4 Receptor Antibody Target Details IL4 Receptor Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL4 Receptor Antibody Target Details IL4 Receptor Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL4 Receptor alpha Antibody [NBP2-33592] - bone marrow
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL4 Receptor alpha Antibody [NBP2-33592] - breast cancer
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL4 Receptor alpha Antibody [NBP2-33592] - Immunohisto...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL-4 R alpha Antibody - Staining of human tonsil show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL-4 R alpha Antibody - Staining of human tonsil show...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL-4 R alpha Antibody - Staining of human cerebral co...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL-4 R alpha Antibody - Staining of human prostate sh...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL-4 R alpha Antibody - Staining of human small intes...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 4 Receptor (IL4R) antibody (ABIN4325317) Immunohistochemistry-Paraffin: IL-4 R alpha Antibody - Staining in human tonsil and ...