anti-Rat (Rattus) Leptin antibody for Immunocytochemistry

Recommended Leptin Antibody (supplied by: Log in to see )

Leptin (LEP) Antibodies
  • ob
  • obese
  • LEPD
  • OB
  • OBS
  • leptin
  • Lep
  • LEP
  • lep
Human, Mouse (Murine), Rat (Rattus)
This Leptin antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4892220
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1078273 ICC IHC WB Rabbit IgG AA 22-167 Log in to see Polyclonal 0
1 ABIN152764 ICC IHC IHC (fro) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN3201296 ICC IHC (fro) IHC (p) ELISA WB Mouse IgG Log in to see 0
1 ABIN5565628 FACS ICC IF IHC APC Rabbit Log in to see Polyclonal 0
1 ABIN5565629 FACS ICC IF IHC FITC Rabbit Log in to see Polyclonal 0
1 ABIN5565631 FACS ICC IF IHC PE Rabbit Log in to see Polyclonal 0


Antigen Leptin (LEP) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(442), (178), (156), (26), (9), (6), (6), (5), (5), (5), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(388), (227), (20), (10), (4), (1), (1)
Conjugate This Leptin antibody is un-conjugated
(70), (30), (19), (11), (10), (9), (9), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(453), (414), (145), (53), (52), (46), (39), (30), (29), (27), (26), (17), (13), (9), (5), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Leptin Antibody

Target Details Leptin Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected from the middle region of LEP (NP_000221). Peptide sequence LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM.
Plasmids, Primers & others

Target Details Leptin

Product Details anti-Leptin Antibody Application Details Handling Images back to top
Alternative Name Leptin/OB (LEP Antibody Abstract)
Background Gene Symbol: LEP
Molecular Weight Theoretical MW: 16 kDa
Gene ID 3952
UniProt P41159
Pathways JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process

Application Details

Product Details anti-Leptin Antibody Target Details Leptin Handling Images back to top
Application Notes Western Blot 0.2-1 μg/mL, Immunohistochemistry 4-8 μg/mL, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 4-8 μg/mL, ImmunocytochemistryThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Leptin Antibody Target Details Leptin Application Details Images back to top
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling back to top
Supplier Images
Simple Western (SimWes) image for anti-Leptin (LEP) antibody (ABIN4892220) Simple Western: Leptin/OB Antibody [NBP1-59324] - Simple Western analysis of Leptin. ...
Immunocytochemistry (ICC) image for anti-Leptin (LEP) antibody (ABIN4892220) Immunocytochemistry: Leptin/OB Antibody [NBP1-59324] - Rat and mouse brain, 10 ug/ml....
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Leptin (LEP) antibody (ABIN4892220) Immunohistochemistry-Paraffin: Leptin/OB Antibody [NBP1-59324] - Human pancreas tissu...
Western Blotting (WB) image for anti-Leptin (LEP) antibody (ABIN4892220) Western Blot: Leptin/OB Antibody [NBP1-59324] - Titration: 0.2-1 ug/ml, Positive Cont...