anti-Rat (Rattus) Leptin antibody for Western Blotting

Recommended Leptin Antibody (supplied by: Log in to see )

Leptin (LEP) Antibodies
  • ob
  • obese
  • LEPD
  • OB
  • OBS
  • leptin
  • Lep
  • LEP
  • lep
Middle Region
Human, Mouse (Murine), Rat (Rattus)
This Leptin antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN634796
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
17.5 ABIN668243 IF (p) IHC (p) WB Rabbit IgG AA 1-50 Log in to see Polyclonal 2
17.056355 ABIN1169158 ELISA WB Mouse IgG2a Log in to see RLEP 227 0
17.056355 ABIN1169153 ELISA WB Biotin Rabbit Log in to see Polyclonal 0
17.056355 ABIN1169150 ELISA WB Rabbit Log in to see Polyclonal 0
16.803753 ABIN1078273 ICC IHC WB Rabbit IgG AA 22-167 Log in to see Polyclonal 0
16.803753 ABIN2937340 IF/ICC IHC IP WB Rabbit AA 22-167 Log in to see Polyclonal 0
15.303753 ABIN2776943 IHC WB Rabbit N-Term Log in to see Polyclonal 1
13.252602 ABIN1169161 ELISA WB Mouse IgG2a Log in to see RLEP 227 0
13.252602 ABIN927193 WB Rabbit IgG C-Term Log in to see Polyclonal 0
13.252602 ABIN289489 Inhibition ELISA WB Goat Log in to see Polyclonal 0
13.252602 ABIN5622041 WB Rabbit IgG Log in to see Polyclonal 0
10.803753 ABIN2776944 IHC WB Rabbit Middle Region Log in to see Polyclonal 0
10 ABIN725030 IF (p) IHC (p) WB Rabbit IgG AA 90-130 Log in to see Polyclonal 0
10 ABIN465028 ELISA WB Goat Log in to see Polyclonal 0
9.303753 ABIN5692874 ELISA WB Rabbit AA 22-167 Log in to see Polyclonal 1
8.5 ABIN5518931 ELISA WB Rabbit IgG AA 22-167 Log in to see Polyclonal 1
7 ABIN604739 IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
5.5 ABIN5692873 ELISA IHC (p) WB Rabbit AA 22-167 Log in to see Polyclonal 1
4.803753 ABIN1876874 IHC WB Rabbit IgG Log in to see Polyclonal 0
4.803753 ABIN2467855 WB Chicken full length Log in to see Polyclonal 0


Antigen Leptin (LEP) Antibodies
Epitope Middle Region
(34), (19), (17), (15), (15), (15), (10), (9), (6), (6), (6), (6), (6), (4), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(423), (178), (157), (26), (9), (6), (6), (5), (5), (5), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(389), (207), (21), (10), (4), (1), (1)
Conjugate This Leptin antibody is un-conjugated
(68), (29), (18), (11), (10), (8), (8), (6), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2)
Application Western Blotting (WB)
(448), (395), (132), (54), (42), (39), (39), (30), (29), (28), (26), (17), (16), (9), (5), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Leptin Antibody

Target Details Leptin Application Details Handling Images
Specificity Leptin antibody was raised against the middle region of LEP
Purification Affinity purified
Immunogen Leptin antibody was raised using the middle region of LEP corresponding to a region with amino acids LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM
Plasmids, Primers & others

Target Details Leptin

Product Details anti-Leptin Antibody Application Details Handling Images back to top
Alternative Name Leptin (LEP Antibody Abstract)
Background LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.
Molecular Weight 16 kDa (MW of target protein)
Pathways JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process

Application Details

Product Details anti-Leptin Antibody Target Details Leptin Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Leptin Blocking Peptide, catalog no. 33R-5033, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Restrictions For Research Use only


Product Details anti-Leptin Antibody Target Details Leptin Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Leptin (LEP) (Middle Region) antibody (ABIN634796) Leptin antibody used at a concentration of 10 ug/ml to detect neuronal processes in t...
Immunohistochemistry (IHC) image for anti-Leptin (LEP) (Middle Region) antibody (ABIN634796) Leptin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Ma...
Western Blotting (WB) image for anti-Leptin (LEP) (Middle Region) antibody (ABIN634796) Leptin antibody used at 1 ug/ml to detect target protein.