anti-Rat (Rattus) PTPN6 antibody for Immunofluorescence

Recommended PTPN6 Antibody (supplied by: Log in to see )

Antigen
Protein-tyrosine Phosphatase 1C (PTPN6) Antibodies
  • HCPH
  • HPTP1C
  • PTP-1C
  • SH-PTP1
  • SHP-1
  • SHP-1L
  • SHP1
  • DRPLA
  • Hcph
  • Ptp1C
  • me
  • motheaten
  • Ptph6
  • Shp-1
  • fj22f05
  • wu:fj22f05
  • zgc:55501
  • ptpn6
  • protein tyrosine phosphatase, non-receptor type 6
  • protein tyrosine phosphatase, non-receptor type 6 L homeolog
  • PTPN6
  • Ptpn6
  • ptpn6
  • ptpn6.L
Reactivity
Human, Rat (Rattus)
231
101
91
5
4
2
2
2
1
1
1
1
1
Host
Rabbit
156
41
35
Clonality
Polyclonal
Conjugate
This PTPN6 antibody is un-conjugated
9
9
8
3
3
3
3
3
3
3
3
3
3
3
3
3
2
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
169
104
72
39
39
36
21
11
8
8
7
5
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4348608
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.661647 ABIN1874455 IF IHC WB Rabbit IgG Log in to see Polyclonal 0
10.661647 ABIN1870549 IF IHC Rabbit IgG pTyr536 Log in to see Polyclonal 0
1 ABIN5947559 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG C-Term Log in to see SR41-02 0
1 ABIN319255 IF IHC (p) Rabbit pTyr536 Log in to see Polyclonal 4
1 ABIN197592 IF IHC (p) WB Rabbit Tyr536 Log in to see Polyclonal 4
1 ABIN362408 IF IHC Rabbit IgG pTyr536 Log in to see Polyclonal 4
1 ABIN6255949 ELISA ICC IF IHC WB Rabbit IgG pTyr536 Log in to see Polyclonal 0
1 ABIN6264520 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN6265073 ELISA ICC IF IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN363036 IF IHC WB Rabbit IgG AA 534-538 Log in to see Polyclonal 2
1 ABIN2882770 IF IHC Rabbit IgG pTyr536 Log in to see Polyclonal 0
1 ABIN5947558 ICC IF IHC IHC (p) WB Mouse IgG2b Log in to see B5-A4 0
1 ABIN5674404 IF IHC IHC (p) Rabbit pTyr536 Log in to see Polyclonal 0
1 ABIN1842510 IF IHC WB Rabbit IgG pTyr536 Log in to see Polyclonal 0
1 ABIN273701 IF IHC Rabbit IgG pTyr536 Log in to see Polyclonal 0
1 ABIN274221 IF IHC WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Protein-tyrosine Phosphatase 1C (PTPN6) Antibodies
Reactivity Human, Rat (Rattus)
(231), (101), (91), (5), (4), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(156), (41), (35)
Clonality
Polyclonal
Conjugate This PTPN6 antibody is un-conjugated
(9), (9), (8), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(169), (104), (72), (39), (39), (36), (21), (11), (8), (8), (7), (5), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PTPN6 Antibody

Target Details PTPN6 Application Details Handling References for anti-PTPN6 antibody (ABIN4348608) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLK
Isotype IgG
Plasmids, Primers & others

Target Details PTPN6

Product Details anti-PTPN6 Antibody Application Details Handling References for anti-PTPN6 antibody (ABIN4348608) Images back to top
Antigen
Alternative Name PTPN6 (PTPN6 Antibody Abstract)
Background Gene Symbol: PTPN6
Gene ID 5777
Pathways JAK-STAT Signaling, TCR Signaling, TLR Signaling, Nuclear Receptor Transcription Pathway, Positive Regulation of Peptide Hormone Secretion, Steroid Hormone Mediated Signaling Pathway, Response to Growth Hormone Stimulus, Regulation of Leukocyte Mediated Immunity, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2

Application Details

Product Details anti-PTPN6 Antibody Target Details PTPN6 Handling References for anti-PTPN6 antibody (ABIN4348608) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PTPN6 Antibody Target Details PTPN6 Application Details References for anti-PTPN6 antibody (ABIN4348608) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PTPN6 antibody (ABIN4348608)

Product Details anti-PTPN6 Antibody Target Details PTPN6 Application Details Handling Images back to top
Product cited in:

McKenzie, Jones, Tosi, Caesar, Whittaker, Mitchell: "Constitutive activation of STAT3 in Sézary syndrome is independent of SHP-1." in: Leukemia, Vol. 26, Issue 2, pp. 323-31, 2012

Images

Product Details anti-PTPN6 Antibody Target Details PTPN6 Application Details Handling References for anti-PTPN6 antibody (ABIN4348608) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Protein-tyrosine Phosphatase 1C (PTPN6) antibody (ABIN4348608) Immunocytochemistry/Immunofluorescence: PTPN6 Antibody [NBP1-83276] - Staining of hum...
Western Blotting (WB) image for anti-Protein-tyrosine Phosphatase 1C (PTPN6) antibody (ABIN4348608) Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein-tyrosine Phosphatase 1C (PTPN6) antibody (ABIN4348608) Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Staining of human lymph ...
Western Blotting (WB) image for anti-Protein-tyrosine Phosphatase 1C (PTPN6) antibody (ABIN4348608) Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32...
Immunofluorescence (IF) image for anti-Protein-tyrosine Phosphatase 1C (PTPN6) antibody (ABIN4348608) Immunocytochemistry/Immunofluorescence: PTPN6 Antibody - Immunofluorescent staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein-tyrosine Phosphatase 1C (PTPN6) antibody (ABIN4348608) Immunohistochemistry-Paraffin: PTPN6 Antibody - Staining of human tonsil shows high ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein-tyrosine Phosphatase 1C (PTPN6) antibody (ABIN4348608) Immunohistochemistry-Paraffin: PTPN6 Antibody - Staining of human skeletal muscle sh...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein-tyrosine Phosphatase 1C (PTPN6) antibody (ABIN4348608) Immunohistochemistry-Paraffin: PTPN6 Antibody - Staining in human tonsil and skeleta...